Identifiers and Description

Gene Model Identifier

TTHERM_00313730

Standard Name

THD11 (Tetrahymena Histone Deacetylase 11)

Aliases

PreTt03560 | 30.m00369 | 3810.m01981

Description

THD11 SIR2 family transcriptional regulator; Sir2-like histone deacetylase; suppresses DNA transcription by deacetylation of histones

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_03386.1 9.997093137033517e-262
Description: transcriptional regulator, Sir2 family protein (387 aa)
Oxytricha Contig19063.0.g74 2.9990837046884738e-127
Description: Sir2 family
Stentor Coeruleus SteCoe_10597 1.1677812485237086e-60
Description: None
WormBase WBGene00004803 1.0000422327488734e-24
Description: locus:sir-2.4 NAD-dependent protein deacetylase sir-2.4 status:Confirmed UniProt:Q95Q89 protein_id:CCD61225.1
DictyBase DDB_G0283917 4.0009493637353324e-18
Description: sir2A on chromosome: 4 position 1272110 to 1273864
SGD YPL015C 0.000000000000006000101554955223
Description: HST2 Cytoplasmic member of the silencing information regulator 2 (Sir2) family of NAD(+)-dependent protein deacetylases; modulates nucleolar (rDNA) and telomeric silencing; possesses NAD(+)-dependent histone deacetylase activity in vitro

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00313730(coding)
ATGGATACTGCTCATAAAACAGTAAACGAAAAGAAAGAATACTTTGATTCTCCGGAATTA
TTAGAAGCAAAAGTCACTTAGTTGGCAGATATGATTAAATAGTCAAATCACTTTGTTTGC
TTTACAGGTGCTGGAATATCTACTTCAGCAGGTATAGCTGATTTTAGAAGTGGAGTTAAC
ACAGTCTTGAAAACTGGACCTGGTTTGTGGGAAAAGATGGCTTAAAAAGTAGGAAATCAA
CCTAAAAAACACAAAGTTATAATGTCTAGAGCTGTTCCAACTAAAAGCCATATGGCACTA
GTTAAGTTGAATCAAGAAGGAATTCTTAAGTATTTAATCAGTTAAAATATAGACGGCTTA
CATAGAAGAAGTGGATTCAACCCTAATAGCCTATCTGAACTACATGGAAACACTAATTTA
GAGAAATGTTTAAAATGTGGAAAGTCTTATATGAGAGATTATAGAGTGAGAAAAGCTTTA
GATGTTCATGACCACTTAACAGGAAGGATTTGCGACAATTAGAAATGTGGTGGCGAATTA
GTAGATACAATTGTTAATTTTGGAGAGAATTTACCCAAAAAAGATATGGAATAAGGTTTT
TTTAACTCAAAATAAGCAGATTTACACTTAGTTTTAGGAAGTAGTTTAAGAGTTACTCCA
GCAGCTGATATGCCTCTAGCAACTGCTTAAAATGGAAATAAATTAGTTGTGGTTAATTTA
CAAAAAACCCCTCTAGATAGCTTGTGTGCCTTAAGAATATATGCTTTGATTGATGATGTC
ATGGTTCTACTTATGAAAAAGCTAGGTTTAGAGATACCAGAATTTATTCTGCAGAGAACT
ATTGTGATTAAAAAGACAAACTAAAATACAATAAACGTTTTTAGTGAAGACAAAGATGGT
TGTCCATATGACATTTTTAAGTAAATTGTTTTGGATTAAGGCAAAAAGTAACCATTTGAG
ATTTAGGTTAAAGCACCTTACATATTCAATATCACAAATCCATAATTTGCCATAAAGCTA
GGATTTTTTGAACATTATAAAGAAGGACCATTCAGATTAGATTTAAATTTATAAAATCTA
CCTCTTGGATAAAAGACTAAGTATTTAATATAATTCTCACCAAAATTACAAAAGTGGATT
AGTTGTGAAAAAATATAATGA


>TTHERM_00313730(gene)
ATGGATACTGCTCATAAAACAGTAAACGAAAAGAAAGAATACTTTGATTCTCCGGAATTA
TTAGAAGCAAAAGTCACTTAGTTGGCAGATATGATTAAATAGTCAAATCACTTTGTTTGC
TTTACAGGTGCTGGAATATCTACTTCAGCAGGTATAGCTGATTTTAGAAGTGGAGTTAAC
ACAGTCTTGAAAACTGGACCTGGTTTGTGGGAAAAGATGGCTTAAAAAGTAGGAAATCAA
CCTAAAAAACACAAAGTTATAATGTCTAGAGCTGTTCCAACTAAAAGCCATATGGCACTA
GTTAAGTTGAATCAAGAAGGAATTCTTAAGTATTTAATCAGTTAAAATATAGACGGCTTA
CATAGAAGAAGTGGATTCAACCCTAATAGCCTATCTGAACTACATGGAAACACTAATTTA
GAGAAATGTTTAAAATGTGGAAAGTCTTATATGAGAGATTATAGAGTGAGAAAAGCTTTA
GATGTTCATGACCACTTAACAGGAAGGATTTGCGACAATTAGAAATGTGGTGGCGAATTA
GTAGATACAATTGTTAATTTTGGAGAGAATTTACCCAAAAAAGATATGGAATAAGGTTTT
TTTAACTCAAAATAAGCAGATTTACACTTAGTTTTAGGAAGTAGTTTAAGAGTTACTCCA
GCAGCTGATATGCCTCTAGCAACTGCTTAAAATGGAAATAAATTAGTTGTGGTTAATTTA
CAAAAAACCCCTCTAGATAGCTTGTGTGCCTTAAGAATATATGCTTTGATTGATGATGTC
ATGGTTCTACTTATGAAAAAGCTAGGTTTAGAGATACCAGAATTTATTCTGCAGAGAACT
ATTGTGATTAAAAAGACAAACTAAAATACAATAAACGTTTTTAGTGAAGACAAAGATGGT
TGTCCATATGACATTTTTAAGTAAATTGTTTTGGATTAAGGCAAAAAGTAACCATTTGAG
ATTTAGGTTAAAGCACCTTACATATTCAATATCACAAATCCATAATTTGCCATAAAGCTA
GGATTTTTTGAACATTATAAAGAAGGACCATTCAGATTAGATTTAAATTTATAAAATCTA
CCTCTTGGATAAAAGACTAAGTATTTAATATAATTCTCACCAAAATTACAAAAGTGGATT
AGTTGTGAAAAAATATAATGA


>TTHERM_00313730(protein)
MDTAHKTVNEKKEYFDSPELLEAKVTQLADMIKQSNHFVCFTGAGISTSAGIADFRSGVN
TVLKTGPGLWEKMAQKVGNQPKKHKVIMSRAVPTKSHMALVKLNQEGILKYLISQNIDGL
HRRSGFNPNSLSELHGNTNLEKCLKCGKSYMRDYRVRKALDVHDHLTGRICDNQKCGGEL
VDTIVNFGENLPKKDMEQGFFNSKQADLHLVLGSSLRVTPAADMPLATAQNGNKLVVVNL
QKTPLDSLCALRIYALIDDVMVLLMKKLGLEIPEFILQRTIVIKKTNQNTINVFSEDKDG
CPYDIFKQIVLDQGKKQPFEIQVKAPYIFNITNPQFAIKLGFFEHYKEGPFRLDLNLQNL
PLGQKTKYLIQFSPKLQKWISCEKIQ