Identifiers and Description

Gene Model Identifier

TTHERM_00316010

Standard Name

APE4 (Adaptor Protein 4 complex Epsilon subunit 4)

Aliases

PreTt20912 | 31.m00214 | 3687.m00016

Description

APE4 adaptin amine-terminal region protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08491.1 9.997093137033517e-262
Description: adaptin N-terminal region family protein (919 aa)
Oxytricha Contig20452.0.1.g17 9.997093137033517e-262
Description: Adaptin N terminal region
DictyBase DDB_G0280427 2.9986068920536807e-84
Description: ap4e1 on chromosome: 3 position 3335352 to 3338884
Stentor Coeruleus SteCoe_25774 8.074506789675094e-73
Description: None
WormBase WBGene00000158 4.001202823045957e-54
Description: locus:apg-1 status:Partially_confirmed UniProt:Q8WQB3 protein_id:CAD21660.1
SGD YPL195W 2.000620012690291e-23
Description: APL5 Delta adaptin-like subunit of the clathrin associated protein complex (AP-3); functions in transport of alkaline phosphatase to the vacuole via the alternate pathway, suppressor of loss of casein kinase 1 function

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316010(coding)
ATGAGTTAATCATAACAGCTAACCAAAGAAATGCATGACTTAATCAAGTCTATAGGTGAG
ACTCGTTCTAAGCAAGAAGAAGATAAAATCATCCTTGCTGAATAAGCCAAATTGAAGGTT
TCAATTAAAGATTAATCGCTTTCAACTCGTAGATAGAAGGAAAATTTGATCAAAGCAATT
TATATTGAAATGTTAGGACACGATGCTAGTTTCGCACATTTCAGCGCAGTTTAAATGGCT
CAATCAAAAAGTCTTTAAATGAAGAGACTTGGTTATTTAACTTGCTGTCTCTTTTTGAAT
GAATAAAGTGATCTTCTCATTCTTCTTGTTGCAAATTTGTAAAAAGATCTGTAATCTAAA
AACATCCACGAAGTCGTAATAGCCTTAACTGCATTAGGAAAGTTAATGAACAAGACTATT
TTACAAGGTGTCTTAGATTTGATCATAAAATTGTTAATACATCACACTGATTTGGTAAGA
AAGAAAGCTATCATGGTATTACAAAGAATTCACAACATTTCTCCTGATTCAATTCCTGAT
TACGATGATAAAATGCGCCGTGCTCTTTGCGATTTCGAACCTTCAGTTATGGGAGTTGCC
CTTAATCTTTACCTTGAAGCTGTTAAGGAAGATCCCACTAAATACAAAGAATCAGCAGGC
TCTTTTGTTTTAATTTTGAAATAAGTTATTGAACACAAATTACCTCGTGAGTTCGACTAT
GCTCGTATTCCTGCTCCTTGGATCTAAATCAAAATTTTATAGATCCTATCTATATTAGGT
AAAAAGGACTAAAAGGTATCAGAATAAATTTATGAAATTTTGGGATAGGCTCTTCGTAGA
AGCGATGATTCAGGAAGCAAGATAGGATTTGCAGTTACTTACTAATGCGTTAAGACTATT
GCTACTATCTATCCCTATTAAAGTCTCCTCGAATAAGCTGCTTCTGCTGTTTAAAGATTT
TTAACTGCTGAAAATAACAATTTGAAGTACTTGGGTATAAATGCTCTCATTTCAATCGTT
TAGGTAAATGCTGCTTATGTCCATGAGCATTAATTAATCATTATTGACTGCTTAGAAAGC
AATGATGAAACTTTGAAGAAAGAGACTATGGAACTCTTATATAAAATGACTAATGTTAAG
AATGTAGAAGCTATAGTTGGTAGACTAATTGTATTCTTGAAAACAAGCTCTGATCCTTTC
TTCAGAAGAAATTTAGTAAACAAAATTACTTCCTTGGCTGATAGACATTCTCCAAGCAAT
GAATGGTTCTTAAAAACTATGAATCTCGTATTTGAGTACGGTAGTGAGTACATCAGCAGC
GATATTTTGAACACCTTCTTAAAAACTTTGAATGAAAATTTCTCCGCAAGTGGAGTCTAA
TTTGGTACTTACTTGATTGATACTTACTTAGAAACAATTAAGAAACCCAATCTCTCTGAC
GTAACCTTTTAAATGATCGCTTGGGTTTTTGGTGAAATTGGTGCTGCAACTTATGGTAAC
GATGAAACTTAACTTTAAAAGTTGATTGAATGCTTGCTTGAATCTATCACAAATGATTTT
GAAAATACTTCAACTAGAGGATGGTTCTTGAATGCTTTAGCTAAATTATCTTCTTGCTCT
GCTTTCAATATGCAAGAATAAGTAGCTGCATGTCTCGACTATTATGGGGAATCTCGCTGT
TTAGAAGTATCTTCTAGATCTACAGAATATAAGATTCTTTCAAAGTACAATGCTGCTTTG
AGATAATCTTCTGCTATTAAAGTTGATACCAAGTTAAACTTCCTTAACGATTTTATTGAA
AGATCTGTTAGAAACGGAGCACCTCGTTTTAATTCTAACAAAATTATACAAGCTGTTATG
AGCAACGATAAAGCATTAAACTTTGCACCTGTTGATTCAAGACACACTGCAAAATCAGAT
TAAGAAGAAGTCTTAAAATTAACCAATAATAAGGCTAATCCTTGGGGTTAAGAAGGATTT
GTTTAACCTGAATAACCTGCCAAGGCTCCTATCTAAAAAGAGGCTGAGAAAGGACAAAAG
TCTTTTTCTAATAAAGATTACCCAAGCGGACCATACATACCTGGCACAGATATATGGAAA
AATAAAGAGCAAGATAAACCAAATAGCAATCCTACTCCTCCTCCTCCTAAAAAAGTTGAA
CCTGAAGATACCAAAAAGAAGCAATAAACTAAAATGGCAGAGATGTTTTTCGGTGGAATT
ACAACTACTGGTCCCGCAGCAACCAACACAACTACCACAACAAAGCCTATTGTGTATTAA
AACACTAATCCTTATGGCTAAACTCCTTCAGTCAATAATTAGGCAATTAATTTACTTGAA
GATGATGATTTACCTTCTTTCACTTCTCAAAAACCAGCTGGTCCATCTTTCACTCCCATA
AACATCAATGTTGAATAATATGAAAATTATTGGGAATAATTTAGATTTGAAGAAAACTAA
GATATTAAGAGCAATAAAGTTAAAACAGAATACGAATTCAGAAATATGCTAACTAATATT
GGAATTGGTGTTGTTGAAGTTGATAACAATGAATTAATTTGTGCAGGTAAAAACATCAGT
TCATAAAATATCATGCTTTTGTATGGATCCTACACTGCATTAGGAAATCTTTCAATCACA
ATGAAGTCTAATTCTAAGCAAGAAATTGATTAAATATTTAATACTATCAAAACCAGATTT
GTTTGA


>TTHERM_00316010(gene)
ATGAGTTAATCATAACAGCTAACCAAAGAAATGCATGACTTAATCAAGTCTATAGGTGAG
ACTCGTTCTAAGCAAGAAGAAGATAAAATCATCCTTGCTGAATAAGCCAAATTGAAGGTT
TCAATTAAAGATTAATCGCTTTCAACTCGTAGATAGAAGGAAAATTTGATCAAAGCAATT
TATATTGAAATGTTAGGACACGATGCTAGTTTCGCACATTTCAGCGCAGTTTAAATGGCT
CAATCAAAAAGTCTTTAAATGAAGAGACTTGGTTATTTAACTTGCTGTCTCTTTTTGAAT
GAATAAAGTGATCTTCTCATTCTTCTTGTTGCAAATTTGTAAAAAGATCTGTAATCTAAA
AACATCCACGAAGTCGTAATAGCCTTAACTGCATTAGGAAAGTTAATGAACAAGACTATT
TTACAAGGTGTCTTAGATTTGGTAATTCATTTTTCAAGATTACTTTTAATTTTTCAAAAG
ATATTTTAAAAAATAATTTAACAAATAAATGAGCAATAAATTATTCAATTTGAAAAAGTA
AAATGAAGCTCAACAAATAATAACTGAAATCGAATTATAGATTCTGCATCTTCATTTTAA
ATAATGAAAAATTAAATATTTATTCAAATGTTTGAATATAGTTAAAATGGCTTTAAATTT
ATCAGCTTTTTTATGAAAATCAGAAGAATTTTTTAACAATTTAATTTTTTTTTTGATGCA
TTGATTTTGATGAATATATAAATGTAAGTTTAATTTTTACAAATCGCAAATTAAATTTTA
TATTTTCTCAATAATATATTTTATAAACGCATTCTTTACTTACTAAATGTCCATATTAGT
GATAAAAGCAATAACAAAATTAGTATAAAAAGCTAGCTTTACTAATATCTTTGTTATTTT
AATATGATTAATACTTATTTAGCTTAAATAAATTATCAACTTAAATTCAATAAATAAATT
AAATTTAGATCATAAAATTGTTAATACATCACACTGATTTGGTAAGAAAGAAAGCTATCA
TGGTATTACAAAGAATTCACAACATTTCTCCTGATTCAATTCCTGATTACGATGATAAAA
TGCGCCGTGCTCTTTGCGATTTCGAACCTTCAGTTATGGGAGTTGCCCTTAATCTTTACC
TTGAAGCTGTTAAGGAAGATCCCACTAAATACAAAGAATCAGCAGGCTCTTTTGTTTTAA
TTTTGAAATAAGTTATTGAACACAAATTACCTCGTGAGTTCGACTATGCTCGTATTCCTG
CTCCTTGGATCTAAATCAAAATTTTATAGATCCTATCTATATTAGGTAAAAAGGACTAAA
AGGTATCAGAATAAATTTATGAAATTTTGGGATAGGCTCTTCGTAGAAGCGATGATTCAG
GAAGCAAGATAGGATTTGCAGTTACTTACTAATGCGTTAAGACTATTGCTACTATCTATC
CCTATTAAAGTCTCCTCGAATAAGCTGCTTCTGCTGTTTAAAGATTTTTAACTGCTGAAA
ATAACAATTTGAAGTACTTGGGTATAAATGCTCTCATTTCAATCGTTTAGGTATTTAAAT
AAATATTTTATTTCAAAAAAAAATAGCAGATACCTTTGATATTGATTTCTTTTTAATTGT
CTTCGCATAAATAAATATAAACTAAAATTTATGAATATTATTTTGTAAATAAAAAGGTAA
ATGCTGCTTATGTCCATGAGCATTAATTAATCATTATTGACTGCTTAGAAAGCAATGATG
AAACTTTGAAGAAAGAGACTATGGAACTCTTATATAAAATGACTAATGTTAAGAATGTAG
AAGCTATAGTTGGTAGACTAATTGTATTCTTGAAAACAAGCTCTGATCCTTTCTTCAGAA
GAAATTTAGTAAACAAAATTACTTCCTTGGCTGATAGACATTCTCCAAGCAATGAATGGT
TCTTAAAAACTATGAATCTCGTATTTGAGTACGGTAGTGAGTACATCAGCAGCGATATTT
TGAACACCTTCTTAAAAACTTTGAATGAAAATTTCTCCGCAAGTGGAGTCTAATTTGGTA
CTTACTTGATTGATACTTACTTAGAAACAATTAAGAAACCCAATCTCTCTGACGTAACCT
TTTAAATGATCGCTTGGGTTTTTGGTGAAATTGGTGCTGCAACTTGTAATTTATTTCATA
AATATTTTTAATTAAAATTTGAAATATAATTTAACTTTTTAATAGATGGTAACGATGAAA
CTTAACTTTAAAAGTTGATTGAATGCTTGCTTGAATCTATCACAAATGATTTTGAAAATA
CTTCAACTAGAGGATGGTTCTTGAATGCTTTAGCTAAATTATCTTCTTGCTCTGCTTTCA
ATATGCAAGAATAAGTAGCTGCATGTCTCGACTATTATGGGGAATCTCGCTGTTTAGAAG
TATCTTCTAGATCTACAGAATATAAGATTCTTTCAAAGTACAATGCTGCTTTGAGATAAT
CTTCTGCTATTAAAGTTGATACCAAGTTAAACTTCCTTAACGATTTTATTGAAAGATCTG
TTAGAAACGGAGCACCTCGTTTTAATTCTAACAAAATTATACAAGCTGTTATGAGCAACG
ATAGTAAATTTATTGATTTTAATTCTACATTTTTTATTAAATTTTTTTGATAAAAAACTA
TTCAGAAGCATTAAACTTTGCACCTGTTGATTCAAGACACACTGCAAAATCAGATTAAGA
AGAAGTCTTAAAATTAACCAATAATAAGGCTAATCCTTGGGGTTAAGAAGGATTTGTTTA
ACCTGAATAACCTGCCAAGGCTCCTATCTAAAAAGAGGCTGAGAAAGGACAAAAGTCTTT
TTCTAATAAAGATTACCCAAGCGGACCATACATACCTGGCACAGATATATGGAAAAATAA
AGAGCAAGATAAACCAAATAGCAATCCTACTCCTCCTCCTCCTAAAAAAGTTGAACCTGA
AGATACCAAAAAGAAGCAATAAACTAAAATGGCAGAGATGTTTTTCGGTGGAATTACAAC
TACTGGTCCCGCAGCAACCAACACAACTACCACAACAAAGCCTATTGTGTATTAAAACAC
TAATCCTTATGGCTAAACTCCTTCAGTCAATAATTAGGCAATTAATTTACTTGAAGATGA
TGATTTACCTTCTTTCACTTCTCAAAAACCAGCTGGTCCATCTTTCACTCCCATAAACAT
CAATGTTGAATAATATGAAAATTATTGGGAATAATTTAGATTTGAAGAAAACTAAGATAT
TAAGAGCAATAAAGTTAAAACAGAATACGAATTCAGAAATATGCTAACTAATATTGGAAT
TGGTGTTGTTGAAGTTGATAACAATGAATTAATTTGTGCAGGTAAAAACATCAGTTCATA
AAATATCATGCTTTTGTATGGATCCTACACTGCATTAGGAAATCTTTCAATCACAATGAA
GTCTAATTCTAAGCAAGAAATTGATTAAATATTTAATACTATCAAAACCAGATTTGTTTG
A


>TTHERM_00316010(protein)
MSQSQQLTKEMHDLIKSIGETRSKQEEDKIILAEQAKLKVSIKDQSLSTRRQKENLIKAI
YIEMLGHDASFAHFSAVQMAQSKSLQMKRLGYLTCCLFLNEQSDLLILLVANLQKDLQSK
NIHEVVIALTALGKLMNKTILQGVLDLIIKLLIHHTDLVRKKAIMVLQRIHNISPDSIPD
YDDKMRRALCDFEPSVMGVALNLYLEAVKEDPTKYKESAGSFVLILKQVIEHKLPREFDY
ARIPAPWIQIKILQILSILGKKDQKVSEQIYEILGQALRRSDDSGSKIGFAVTYQCVKTI
ATIYPYQSLLEQAASAVQRFLTAENNNLKYLGINALISIVQVNAAYVHEHQLIIIDCLES
NDETLKKETMELLYKMTNVKNVEAIVGRLIVFLKTSSDPFFRRNLVNKITSLADRHSPSN
EWFLKTMNLVFEYGSEYISSDILNTFLKTLNENFSASGVQFGTYLIDTYLETIKKPNLSD
VTFQMIAWVFGEIGAATYGNDETQLQKLIECLLESITNDFENTSTRGWFLNALAKLSSCS
AFNMQEQVAACLDYYGESRCLEVSSRSTEYKILSKYNAALRQSSAIKVDTKLNFLNDFIE
RSVRNGAPRFNSNKIIQAVMSNDKALNFAPVDSRHTAKSDQEEVLKLTNNKANPWGQEGF
VQPEQPAKAPIQKEAEKGQKSFSNKDYPSGPYIPGTDIWKNKEQDKPNSNPTPPPPKKVE
PEDTKKKQQTKMAEMFFGGITTTGPAATNTTTTTKPIVYQNTNPYGQTPSVNNQAINLLE
DDDLPSFTSQKPAGPSFTPININVEQYENYWEQFRFEENQDIKSNKVKTEYEFRNMLTNI
GIGVVEVDNNELICAGKNISSQNIMLLYGSYTALGNLSITMKSNSKQEIDQIFNTIKTRF
V