Identifiers and Description

Gene Model Identifier

TTHERM_00316500

Standard Name

HTA2 (Histone h Two A 2)

Aliases

H2A.2 | H2A2 | PreTt20961 | 31.m00263 | 3687.m00065

Description

HTA2 histone H2B.1; Histone H2A; one of the four histones (H2A- H2B- H3 and H4) that comprise the nucleosome core; one of two major histone H2A genes (with HTA1); knockout viable- but double knockout with HTA1 inviable

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

External Links

Gene Ontology Annotations

Cellular Component

Molecular Function

Biological Process

Domains

  • ( PF00125 ) Core histone H2A/H2B/H3/H4
  • ( PF00808 ) Histone-like transcription factor (CBF/NF-Y) and

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

Tetrahymena Stock Center

  • ( SD01360 ) Micronucleus: Neo 2 into HTA1, replaces coding
  • ( SD01396 ) Micronucleus: Neo 2 into HTA1, replaces coding
  • ( SD01397 ) Micronucleus: Neo 2 into HTA1, replaces coding
  • ( SD01398 ) Micronucleus: Neo 2 into HTA1, replaces coding
  • ( SD02873 ) Macronucleus: neo2 into HTA2

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08429.1 2.998893725394183e-91
Description: core histone H2A/H2B/H3/H4 family protein (134 aa)
Oxytricha Contig22612.0.g35 9.996907204735647e-62
Description: Core histone H2A/H2B/H3/H4
SGD YDR225W 1.0001801308941382e-55
Description: HTA1 Histone H2A, core histone protein required for chromatin assembly and chromosome function; one of two nearly identical subtypes (see also HTA2); DNA damage-dependent phosphorylation by Mec1p facilitates DNA repair; acetylated by Nat4p
WormBase WBGene00001909 2.000065869309806e-55
Description: locus:his-35 Histone H2A status:Confirmed UniProt:Q27485 protein_id:CAA94747.1
DictyBase DDB_G0279667 2.0006622580855403e-35
Description: H2AX on chromosome: 3 position 2410613 to 2411077
Stentor Coeruleus SteCoe_31046 5.900090541597061e-29
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
  2. Ref:11000274: Jackson JD, Gorovsky MA (2000) Histone H2A.Z has a conserved function that is distinct from that of the major H2A sequence variants. Nucleic acids research 28(19):3811-6
  3. Ref:10385122: Clarkson MJ, Wells JR, Gibson F, Saint R, Tremethick DJ (1999) Regions of variant histone His2AvD required for Drosophila development. Nature 399(6737):694-7
  4. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
  5. Ref:8649398: Liu X, Bowen J, Gorovsky MA (1996) Either of the major H2A genes but not an evolutionarily conserved H2A.F/Z variant of Tetrahymena thermophila can function as the sole H2A gene in the yeast Saccharomyces cerevisiae. Molecular and cellular biology 16(6):2878-87
  6. Ref:8754831: Liu X, Li B, GorovskyMA (1996) Essential and nonessential histone H2A variants in Tetrahymena thermophila. Molecular and cellular biology 16(8):4305-11
  7. Ref:8177745: Liu X, Gorovsky MA (1993) Mapping the 5' and 3' ends of Tetrahymena thermophila mRNAs using RNA ligase mediated amplification of cDNA ends (RLM-RACE). Nucleic acids research 21(21):4954-60
  8. Ref:2587254: Mannironi C, Bonner WM, Hatch CL (1989) H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals. Nucleic acids research 17(22):9113-26
  9. Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
  10. Ref:6706903: Fusauchi Y, Iwai K (1984) Tetrahymena histone H2A. Acetylation in the N-terminal sequence and phosphorylation in the C-terminal sequence. Journal of biochemistry 95(1):147-54
  11. Ref:6885734: Fusauchi Y, Iwai K (1983) Tetrahymena histone H2A. Isolation and two variant sequences. Journal of biochemistry 93(6):1487-97

Sequences

>TTHERM_00316500(coding)
ATGAGCACAACTGGTAAAGGAGGTAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTT
TCTAGATCCGCTAGAGCTGGTCTTTAATTCCCCGTTGGTAGAATTTCCAGATTCTTGAAG
AACGGTAGATACAGTGAAAGAATCGGTACTGGTGCCCCCGTCTACTTGGCCGCTGTCTTA
GAATATTTGGCTGCTGAAGTTCTCGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATTGTCCCCAGACATATTTTATTAGCTATCAGAAATGATGAAGAATTAAATAAA
CTCATGGCCAACACAACTATTGCTGATGGTGGTGTCTTACCCAACATCAACCCCATGCTT
CTTCCTTCTAAGACAAAGAAGTCCACTGAACCTGAACATTGA


>TTHERM_00316500(gene)
ATGAGCACAACTGGTAAAGGAGGTAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTT
TCTAGATCCGCTAGAGCTGGTCTTTAATTCCCCGTTGGTAGAATTTCCAGATTCTTGAAG
AACGGTAGATACAGTGAAAGAATCGGTACTGGTGCCCCCGTCTACTTGGCCGCTGTCTTA
GAATATTTGGCTGCTGAAGTTCTCGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATTGTCCCCAGACATATTTTATTAGCTATCAGAAATGATGAAGAATTAAATAAA
CTCATGGCCAACACAACTATTGCTGATGGTGGTGTCTTACCCAACATCAACCCCATGCTT
CTTCCTTCTAAGACAAAGAAGTCCACTGAACCTGAACATTGA


>TTHERM_00316500(protein)
MSTTGKGGKAKGKTASSKQVSRSARAGLQFPVGRISRFLKNGRYSERIGTGAPVYLAAVL
EYLAAEVLELAGNAAKDNKKTRIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPML
LPSKTKKSTEPEH