Identifiers and Description

Gene Model Identifier

TTHERM_00316500

Standard Name

HTA2 (Histone h Two A 2)

Aliases

H2A.2 | H2A2 | PreTt20961 | 31.m00263 | 3687.m00065

Description

HTA2 histone H2B.1; Histone H2A; one of the four histones (H2A, H2B, H3 and H4) that comprise the nucleosome core; one of two major histone H2A genes (with HTA1); knockout viable, but double knockout with HTA1 inviable; Histone H2A

Genome Browser (Macronucleus)

Full Screen View

No Genome Browser Data Present

Genome Browser (Micronucleus)

Full Screen View

No Genome Browser Data Present

External Links

• Uniprot
• Alphafold

Gene Ontology Annotations

Cellular Component

• macronucleus (TAS) | GO:0031039
• micronucleus (NAS) | GO:0031040
• nucleosome (ISS) | GO:0000786
• nucleus (ISS) | GO:0005634
• subrhabdomeral cisterna (IEA) | GO:0016029

Molecular Function

• 17alpha-hydroxyprogesterone binding (IEA) | GO:1903880
• 2-keto-3-deoxy-L-rhamnonate aldolase activity (IEA) | GO:0106099
• DNA binding (ISS) | GO:0003677
• ferric enterobactin:proton symporter activity (IEA) | GO:0015345
• lanosterol synthase activity (IEA) | GO:0000250
• mitochondrial single subunit type RNA polymerase activity (IEA) | GO:0001065
• obsolete sodium-transporting two-sector ATPase activity (IEA) | GO:0015443
• obsolete zinc, iron permease activity (IEA) | GO:0015342
• phosphatidylserine decarboxylase activity (IEA) | GO:0004609
• phosphoenolpyruvate carboxykinase (ATP) activity (IEA) | GO:0004612
• phosphoenolpyruvate carboxykinase activity (IEA) | GO:0004611
• siderophore-iron transmembrane transporter activity (IEA) | GO:0015343
• type 4 neuropeptide Y receptor binding (IEA) | GO:0031844

Biological Process

• cellular response to homocysteine (IEA) | GO:1905375
• coenzyme A biosynthetic process (IEA) | GO:0015937
• heme A biosynthetic process (IEA) | GO:0006784
• heme biosynthetic process (IEA) | GO:0006783
• inactivation of recombination (HML) (IEA) | GO:0007537
• induction of apoptosis by extracellular signals (IEA) | GO:0008624
• lung connective tissue development (IEA) | GO:0060427
• lung epithelium development (IEA) | GO:0060428
• lung saccule development (IEA) | GO:0060430
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902647
• negative regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902642
• negative regulation of cellular glucuronidation (IEA) | GO:2001030
• negative regulation of PERK-mediated unfolded protein response (IEA) | GO:1903898
• neutral lipid metabolic process (IEA) | GO:0006638
• nucleosome assembly (ISS) | GO:0006334
• obsolete aging (IEA) | GO:0007568
• obsolete extracellular carbohydrate transport (IEA) | GO:0006859
• obsolete regulation of histone H3-K27 methylation (IEA) | GO:0061085
• ommochrome biosynthetic process (IEA) | GO:0006727
• plant-type cell wall modification (IEA) | GO:0009827
• positive regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902643
• positive regulation of dendrite extension (IEA) | GO:1903861
• positive regulation of double-strand break repair via nonhomologous end joining (IEA) | GO:2001034
• positive regulation of oxidative phosphorylation (IEA) | GO:1903862
• positive regulation of phospholipid translocation (IEA) | GO:0061092
• primary lung bud formation (IEA) | GO:0060431
• propan-2-ol biosynthetic process (IEA) | GO:1902640
• protein localization to old growing cell tip (IEA) | GO:1903858
• pyrimidine nucleotide salvage (IEA) | GO:0032262
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate biosynthetic process (IEA) | GO:1902646
• regulation of 1-phosphatidyl-1D-myo-inositol 4,5-bisphosphate catabolic process (IEA) | GO:1902641
• regulation of cytokinin dehydrogenase activity (IEA) | GO:1903856
• regulation of ecdysteroid secretion (IEA) | GO:0007555
• regulation of gastric motility (IEA) | GO:1905333
• regulation of phosphorus utilization (IEA) | GO:0006795
• regulation of plant epidermal cell differentiation (IEA) | GO:1903888
• regulation of RNA binding transcription factor activity (IEA) | GO:1905255
• sesquiterpenoid biosynthetic process (IEA) | GO:0016106
• sperm aster formation (IEA) | GO:0035044
• sperm DNA decondensation (IEA) | GO:0035041
• synaptic vesicle priming (IEA) | GO:0016082
• tertiary alcohol biosynthetic process (IEA) | GO:1902645
• transcription by RNA polymerase V (IEA) | GO:0001060
• tRNA import into mitochondrion (IEA) | GO:0016031

Domains

• ( PF00125 ) Core histone H2A/H2B/H3/H4
• ( PF16211 ) C-terminus of histone H2A

Gene Expression Profile

Vegetative Cell Cycle (Zhang et al., 2023)

GeneMania

No results were calculated for this gene in GeneMania.

Tetrahymena Stock Center

• ( SD01360 ) Micronucleus: Neo 2 into HTA1, replaces coding
• ( SD01396 ) Micronucleus: Neo 2 into HTA1, replaces coding
• ( SD01397 ) Micronucleus: Neo 2 into HTA1, replaces coding
• ( SD01398 ) Micronucleus: Neo 2 into HTA1, replaces coding
• ( SD02873 ) Macronucleus: neo2 into HTA2

Homologs

No Data fetched for Homologs

General Information

No Data fetched for General Information

Associated Literature

1. Ref:12665578: Ren Q, Gorovsky MA (2003) The nonessential H2A N-terminal tail can function as an essential charge patch on the H2A.Z variant N-terminal tail. Molecular and cellular biology 23(8):2778-89
2. Ref:11000274: Jackson JD, Gorovsky MA (2000) Histone H2A.Z has a conserved function that is distinct from that of the major H2A sequence variants. Nucleic acids research 28(19):3811-6
3. Ref:10385122: Clarkson MJ, Wells JR, Gibson F, Saint R, Tremethick DJ (1999) Regions of variant histone His2AvD required for Drosophila development. Nature 399(6737):694-7
4. Ref:8760889: Liu X, Gorovsky MA (1996) Cloning and characterization of the major histone H2A genes completes the cloning and sequencing of known histone genes of Tetrahymena thermophila. Nucleic acids research 24(15):3023-30
5. Ref:8649398: Liu X, Bowen J, Gorovsky MA (1996) Either of the major H2A genes but not an evolutionarily conserved H2A.F/Z variant of Tetrahymena thermophila can function as the sole H2A gene in the yeast Saccharomyces cerevisiae. Molecular and cellular biology 16(6):2878-87
6. Ref:8754831: Liu X, Li B, GorovskyMA (1996) Essential and nonessential histone H2A variants in Tetrahymena thermophila. Molecular and cellular biology 16(8):4305-11
7. Ref:8177745: Liu X, Gorovsky MA (1993) Mapping the 5' and 3' ends of Tetrahymena thermophila mRNAs using RNA ligase mediated amplification of cDNA ends (RLM-RACE). Nucleic acids research 21(21):4954-60
8. Ref:2587254: Mannironi C, Bonner WM, Hatch CL (1989) H2A.X. a histone isoprotein with a conserved C-terminal sequence, is encoded by a novel mRNA with both DNA replication type and polyA 3' processing signals. Nucleic acids research 17(22):9113-26
9. Ref:3131141: Brandt WF, de Andrade Rodrigues J, von Holt C (1988) The amino acid sequence of wheat histone H2B(2). A core histone with a novel repetitive N-terminal extension. European journal of biochemistry 173(3):547-54
10. Ref:6706903: Fusauchi Y, Iwai K (1984) Tetrahymena histone H2A. Acetylation in the N-terminal sequence and phosphorylation in the C-terminal sequence. Journal of biochemistry 95(1):147-54
11. Ref:6885734: Fusauchi Y, Iwai K (1983) Tetrahymena histone H2A. Isolation and two variant sequences. Journal of biochemistry 93(6):1487-97

Sequences

>TTHERM_00316500(coding)
ATGAGCACAACTGGTAAAGGAGGTAAAGCTAAAGGTAAAACCGCTTCATCCAAGCAAGTT
TCTAGATCCGCTAGAGCTGGTCTTTAATTCCCCGTTGGTAGAATTTCCAGATTCTTGAAG
AACGGTAGATACAGTGAAAGAATCGGTACTGGTGCCCCCGTCTACTTGGCCGCTGTCTTA
GAATATTTGGCTGCTGAAGTTCTCGAATTGGCTGGTAACGCTGCTAAGGACAACAAGAAG
ACCAGAATTGTCCCCAGACATATTTTATTAGCTATCAGAAATGATGAAGAATTAAATAAA
CTCATGGCCAACACAACTATTGCTGATGGTGGTGTCTTACCCAACATCAACCCCATGCTT
CTTCCTTCTAAGACAAAGAAGTCCACTGAACCTGAACATTGA

>TTHERM_00316500(gene)
AGGATTCTTCAAATTAATATAATTCAAAAACAAATAAAAATTAACAATCAATAAAAAAAG
AGATAATAATAACGATGAGCACAACTGGTAAAGGAGGTAAAGCTAAAGGTAAAACCGCTT
CATCCAAGCAAGTTTCTAGATCCGCTAGAGCTGGTCTTTAATTCCCCGTTGGTAGAATTT
CCAGATTCTTGAAGAACGGTAGATACAGTGAAAGAATCGGTACTGGTGCCCCCGTCTACT
TGGCCGCTGTCTTAGAATATTTGGCTGCTGAAGTTCTCGAATTGGCTGGTAACGCTGCTA
AGGACAACAAGAAGACCAGAATTGTCCCCAGACATATTTTATTAGCTATCAGAAATGATG
AAGAATTAAATAAACTCATGGCCAACACAACTATTGCTGATGGTGGTGTCTTACCCAACA
TCAACCCCATGCTTCTTCCTTCTAAGACAAAGAAGTCCACTGAACCTGAACATTGATTAA
TTGAAATTAAAACCTATACAAAAAAACTTACTTAATTTATAAACATATATATACTTTTTT
GTAAAATAGAGTTTGTGTGTATTCTTTCTAATTAAGCATTTCTAAGCTAATTAGTTAG

>TTHERM_00316500(protein)
MSTTGKGGKAKGKTASSKQVSRSARAGLQFPVGRISRFLKNGRYSERIGTGAPVYLAAVL
EYLAAEVLELAGNAAKDNKKTRIVPRHILLAIRNDEELNKLMANTTIADGGVLPNINPML
LPSKTKKSTEPEH