Identifiers and Description

Gene Model Identifier

TTHERM_00316530

Standard Name

PUP3 (20S proteasome core beta subunit 3)

Aliases

PreTt20964 | 31.m00266 | 3687.m00068

Description

PUP3 proteasome subunit beta type protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • 17-beta-hydroxysteroid dehydrogenase (NADP+) activity (IEA) | GO:0072582

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08424.1 3.999836123447869e-144
Description: proteasome A-type and B-type family protein (210 aa)
Oxytricha Contig22736.0.g93 3.0013199058937152e-77
Description: Proteasome subunit
SGD YER094C 3.000745802558524e-63
Description: PUP3 Beta 3 subunit of the 20S proteasome involved in ubiquitin-dependent catabolism; human homolog is subunit C10
WormBase WBGene00003949 3.000969471571755e-58
Description: locus:pbs-3 Proteasome subunit beta type-3 status:Confirmed UniProt:Q23237 protein_id:CCD73694.1
DictyBase DDB_G0269772 1.9997255150861791e-53
Description: psmB3 on chromosome: 1 position 3525818 to 3526839
Stentor Coeruleus SteCoe_19400 1.185064864233981e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00316530(coding)
ATGGGTGATCCTTTTTCATATAATGGTGGTTCAATGCTTGCCATGAAGGGTGAATAATGT
GTAGCAATAGGTGCTGATCGTCGTTTGGGTGCATAATTCCAAACTGTAGCCACCAATTTC
CAAAAGGTTTTCAGAATCTAAGATAATATTCTTTTAGGTTTGACTGGTCTTGCAACTGAT
GTTTAAACATTCCACCGTTTAATTTAATATAAAGTAAACTTATACAGACTTAGAGAAAAT
AAAGACATGAAAGTTAATACTTTTGTAAATCTTATTTCTGCTACTCTCTACGAAAAAAGA
TGGGGTCCTTATTTTGTTTCACCTATTGTTGCTGGTTTAGAATATGATGAAGTAAAAGGT
GTTATTCCAATCACTGCTACTTATGACTCTATCGGTTGTACCTCTATTGAAGGAGAATTC
TAAGTTGGAGGAACTGGTGCTGATGGTTTAATAGGTTCTTGTGAATCCTTCTGGAGAAAA
GGTCTCAAGCCCGATGAGTTAGAAGACATCGTTGCATAAAGTTTAAGTGCTGGTTGTGAT
AGAGATATTCTTTCAGGTTGGGGTGGAGTAGTCTACACATTAACCAAAGACAATTTATCA
GTAAAAGTACTTAAGACCAAGCAATCTTGA


>TTHERM_00316530(gene)
ATGGGTGATCCTTTTTCATATAATGGTGGTTCAATGCTTGCCATGAAGGGTGAATAATGT
GTAGCAATAGGTGCTGATCGTCGTTTGGGTGCATAATTCCAAACTGTAGCCACCAATTTC
CAAAAGGTTTTCAGAATCTAAGATAATATTCTTTTAGGTTTGACTGGTCTTGCAACTGAT
GTTTAAACATTGTAAATTAAAAATAAATGATTATTGAATTAGAATTTAAAAGAAAAATGT
TTAATTCACGAAATGTCATAAATAAAAAACACAATTTCATCAATAGATGAGATAGTAGAC
ATTAAATGAACACTTTTCATGAGCTTTCAATAACTAACAGAAGCCATATATTTACTTTTT
TAATTTAAAATATAGCCACCGTTTAATTTAATATAAAGTAAACTTATACAGACTTAGAGA
AAATAAAGACATGAAAGTTAATACTTTTGTAAATCTTATTTCTGCTACTCTCTACGAAAA
AAGGTAAACAAACCAAACCTATTTTCTACTTTAACTTAAGACGCAAATCATTAAATATCT
TTTGTTGATAAACTGTTTGGTGTAAAAACGTAAAGAATGTCAATCAAAATTAATTAATGA
GATTGTCATCTTTACTTGGAGAATACATCTTATTAATAAAGTTATTCAAATAAATGTTAT
TAAGGAAGGCTTTTTAAATTAGATTTAAAATCTTTGCACAATTTAATGAATCGTAAAGAC
AATAAAAACATTTATAAAGAGCTTTTTAATTTAAAAATAAAAGAGGAAAGATTTGCTAAA
GATTATTTATTTATTTATTTTTAGATAATAAAATCACAATAATTAGATGATTTACATTAA
TTTTATTAATTTGGTAATAAATCATTTTTAAACTAAAATAGATGGGGTCCTTATTTTGTT
TCACCTATTGTTGCTGGTTTAGAATATGATGAAGTAAAAGGTGTTATTCCAATCACTGCT
ACTTATGACTCTATCGGTTGTACCTCTATTGAAGGAGAATTCTAAGTTGGAGGAACTGGT
GCTGATGGTTTAATAGGTTCTTGTGAATCCTTCTGGAGAAAAGGTCTCAAGCCCGATGAG
TTAGAAGACATCGTTGCATAAAGTTTAAGTGCTGGTTGTGATAGAGATATTCTTTCAGGT
TGGGGTGGAGTAGTCTACACATTGTAAATATATTTAAAATAATTAGCAAATAAATAAATT
TTTTATTTAAAATTAGAACCAAAGACAATTTATCAGTAAAAGTACTTAAGACCAAGCAAT
CTTGA


>TTHERM_00316530(protein)
MGDPFSYNGGSMLAMKGEQCVAIGADRRLGAQFQTVATNFQKVFRIQDNILLGLTGLATD
VQTFHRLIQYKVNLYRLRENKDMKVNTFVNLISATLYEKRWGPYFVSPIVAGLEYDEVKG
VIPITATYDSIGCTSIEGEFQVGGTGADGLIGSCESFWRKGLKPDELEDIVAQSLSAGCD
RDILSGWGGVVYTLTKDNLSVKVLKTKQS