Identifiers and Description

Gene Model Identifier

TTHERM_00316560

Standard Name

SEP2 (SEPtin 2)

Aliases

PreTt20967 | 31.m00269 | 3687.m00071

Description

SEP2 septin protein; Septin 2- Cell division protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • oxoglutarate:malate antiporter activity (IEA) | GO:0015367

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08421.1 9.997093137033517e-262
Description: cell division protein (570 aa)
WormBase WBGene00006793 5.001425520048966e-32
Description: locus:unc-59 status:Confirmed UniProt:Q9U334 protein_id:CAB63329.1
Oxytricha Contig4578.0.g7 4.001033848388204e-30
Description: Septin
SGD YCR002C 2.000130478826482e-26
Description: CDC10 Component of the septin ring that is required for cytokinesis; septins recruit proteins to the mother-bud neck and can act as a barrier to diffusion at the membrane, and they comprise the 10 nm filaments seen with EM; required for the transition from a single to double septin ring
Stentor Coeruleus SteCoe_27278 5.242885663363464e-22
Description: None
DictyBase DDB_G0292318 0.0004999512321494991
Description: rsmD on chromosome: 6 position 1471614 to 1472506

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18586950: Wloga D, Strzyzewska-Jówko I, Gaertig J, Jerka-Dziadosz M (2008) Septins stabilize mitochondria in Tetrahymena thermophila. Eukaryotic cell 7(8):1373-86

Sequences

>TTHERM_00316560(coding)
ATGGACAATCAAAGAGTTCCATTTCCAACAAAAGCAACAAATAACCCAAATTAATTCTTT
TCGGCTTTCGAAAGAAATCAAAATGAATCAGGAGAATAGATATTCAATCGAACTTTTACC
AGAAGCATTGAATCAAGTCATTGGGATAATGATAATTCTAACTTGTTGGCTGATTTAGAG
GAACTTGATTAAATTAAATAAAAACAAGCAGATCAAAGAAACTCAAATAAAAATGATTTT
TCAAAGTTAGATAAATAATATTTGAACGAGATGCTCTAATAGTAGTAAAAAAAAATAGGC
AACATTTTAGAAGTGAGCTCACCTCAAAAAAGCAGTCCATAAATACCTTAAAAATAAGAA
AATACTTTCTTTCCTGATCAAGATTTAAAGTTTAAAAAGCAAACAAGTTAAAAAAGATCT
GCCCTCTAAGGATCCTTTAATATGTTCCATGGCAAAGATGATAACAGACTAGGGGAAACC
TTAATTTCTGAATATGTCAGCGAAGACTTCCACAGTTAACACAATTCACCCTTAAAAGAG
TTAGTTATCACTTAGACTTAGGTTGGCGGAAACAATTAAAATAATCCCTCTTATTTACAT
ACAAATCAAAATCAAAATTAACTAAGTGTTTTGATAAGCTAATAAGAAGATAATGCATAG
TCTACTTCACATGTTCATAACGAATAATCAGTGCTTTCTATTCTAAAAGAGCATGAGCTT
GAAAAACCTGTATATATAAACGTTATGGTTGCGGGAGCTCAAGGCTTAGGAAAATCTACT
TTTATTGATGCATTTCTCAATAAGAAATTTCATAAAGAATAGCCTGACGTCATCAGACCA
AAGACAGAGGAAATTGTTGAAGTAACTGGCATTCGTACTGAAAACAAAATAAAATTGCAC
TTAAATATGATCGATACACCTGGATACTCTGAAGAAACAAACATTGATGAATGGATTGAT
AAAATTATTAAACATATCGTGGGCAAGTTTGAGAATTACAAATTATTTGAAGATAAATTG
ATCGAAGATATAAAAAGTGTTTAGTAGGAAGATGATAAAGATTGCAGGGTACACGTTTGT
CTCTATTTTATATAAGGAAGAAGCATTTCTAAATTTGATTAAAAAGCTATTCTCAAACTT
TAAGAACATGTTAGCATTATTCCTATCTTAGCAAAAGGAGATACTTACATGATTGAAGAA
GTGAAATAAATCAAGCAAAATATTATTAAAGATGCACATGATAATAAAATAAGCTTTTTT
GATTGTGAAGCACCCTTAAAGAACGATAAAGAAAGACTCTAAAAATTGAGGAATGGACCT
TTTGGACATTCTCCACCATTCCTTATGATATCTTCTGTATAAAAAATAGAAATAGAAAAA
TAAAAAATATATGCAAGAAAATACCCTTGGGGAATATGTAAAATAGAAGATCCAGAACAT
TCTGATTTCTTGCTTCTTTATCAACTTTTGATTGGATACTTCATCGCTGATCTTAAGAAA
CTAACTGATATTATCTACAAGCAATATTTGAAAAAGAAGAAAAAATAAATAAAAGAAGAA
AAGAAAAATAAATAGAATCAGAAATTAATTGGAGGAGGTGTTGCCTTAGCCATAGCAGGA
TTACTTGGCTTTATCAAATATTAAGCCATTAAATGA


>TTHERM_00316560(gene)
ATGGACAATCAAAGAGTTCCATTTCCAACAAAAGCAACAAATAACCCAAATTAATTCTTT
TCGGCTTTCGAAAGAAATCAAAGTAAAATCGCACATTTATTAAATAAAATCTTTTATTAA
AAAATTTTATATTTGATTTAGACAACAGAAACAATCCATATAATCTAGGTAGAAAAATAC
TATTTTACTTGTTTGTTTCTTTATTTACTTGATTTTGCTCTATAAATTTTGTTATACTTT
TTGATAAATACAAAATCAACTAAATCCTATATTAAGTAAATCTATTAGTTTAGAAAGAAA
ATAAAAGAAAATCAGTCACTGATTCTTTCTAAATGACTATTATTCACTAATCAATTAATT
AATTGATTGATTTATAGATTTACTTAGAACAACTGTCTCATTTCCTTTGGATTCAAAATA
GCTTTCATTTAATTCCAATCCTCCAGAAATTAAAAATTTTTTGATGATTGCTAGCTAAAC
ATTTCATTAAATCTTTTTGGCAATATTATTTTTCTTTTTCTAAATTAATTTGATTAACTC
CATTTGTTTGTCAATCTATTTTTGATAAGTTAGCGCTATTTGAACCAATCAAAATTCAAA
AAAAACCTTTATAATAAGCAAGACTAGTTATATGAAACTAGGAAAATAATATCAAAACTG
AACTCAAATTTATTTTTAATGCTAAAAATTTACTCATTACAATAATTATATATTTAGATG
AATCAGGAGAATAGATATTCAATCGAACTTTTACCAGAAGCATTGAATCAAGTCATTGGG
ATAATGATAATTCTAACTTGTTGGCTGATTTAGAGGAACTTGATTAAATTAAATAAAAAC
AAGCAGATCAAAGAAACTCAAATAAAAATGATTTTTCAAAGTTAGATAAATAATATTTGA
ACGAGATGCTCTAATAGTAGTAAAAAAAAATAGGCAACATTTTAGAAGTGAGCTCACCTC
AAAAAAGCAGTCCATAAATACCTTAAAAATAAGAAAATACTTTCTTTCCTGATCAAGATT
TAAAGTTTAAAAAGCAAACAAGTTAAAAAAGATCTGCCCTCTAAGGATCCTTTAATATGT
TCCATGGCAAAGATGATAACAGACTAGGGGAAACCTTAATTTCTGAATATGTCAGCGAAG
ACTTCCACAGTTAACACAATTCACCCTTAAAAGAGTTAGTTATCACTTAGACTTAGGTTG
GCGGAAACAATTAAAATAATCCCTCTTATTTACATACAAATCAAAATCAAAATTAACTAA
GTGTTTTGATAAGCTAATAAGAAGATAATGCATAGTCTACTTCACATGTTCATAACGAAT
AATCAGTGCTTTCTATTCTAAAAGAGCATGAGCTTGAAAAACCTGTAAAAATTGCTATAT
TTTATTAATTCATTATTTATTTATTATTCTCCTATTTTGAATCTTAGAATTAACTTGCCA
TTTTTTTTTCTTTTTTGCAGTCAGTGCATTTCATAAAAAACTTTTATTTAACATTTGAAA
ATAAACAATTGTTCAAAAGACGAAAATTTGGTCATCAAAAATTTTTTCTCTTAACTCTTT
ATTTGAGCTTCATGATCAATTAATCAATCTTAGCTAAATTTTTAACATTTGTATTATTTT
ATACATTTACTGCTCTTAAATTTTAAATAAAAAAGTTGACTTTTTAATGTTCTTAGAAAC
ACTATTACGATGAAGCTATTAGCTTTACAAGCCTTTCATTTTGATTTAAAATAAATAAAT
CATTTTAATCTTTCAATAAATAAATGAATAAATTATGATCAAATGATTGCAATTTTTATG
ATTTTTAAATTATCAGATTTGTTTGATATTAATTTTACAATATTACTGTTATAGCGCTCA
ACTTTATTAGCAATTATATATCAAAATTTAAAATTTAGGAGTTTTTAAAATAGTATGAAA
TAAATAACATCACTCTAAAATATTTCAATCACGTTAAAATAATTATTGAATTAATTAAAA
AGGTATATATAAACGTTATGGTTGCGGGAGCTCAAGGCTTAGGAAAATCTACTTTTATTG
ATGCATTTCTCAATAAGGTATTTATTACATTAAATCTAAAATAGATCAGCCTATTTTTTA
AATTCTTCAAATATTATTCTTAGTGCTATACAAATATAAATTTGTGATATAGTAATTAAT
AATCAAAATATCGGGAAAAAAAGATAATCAGTCACTAAAATTAATTACTTTATCTATTTG
ATCTAACAAAATTTTAAAATAATCTGATTTATTATCATCGATCGCCTTTGTTTTGTATTA
ATTTATTTTTTGTCATCCAAAAAGAAATTTCATAAAGAATAGCCTGACGTCATCAGACCA
AAGACAGAGGAAATTGTTGAAGTAACTGGCATTCGTACTGAAAACAAAATAAAATTGCAC
TTAAATATGATCGATACACCTGGATACTCTGAAGAAACAAACATTGATGAATGGATTGAT
AAAATTATTAAACATATCGTGGGCAAGGTAAAGCAGACAAATTAAATTTACAAATTTTGA
GTTTCATTATTGTTTGTTAATTTTTTTTCTATCTCAAAAAATTTAAAAATACGTTTTTAA
TTTATTTTTAAATTGAACAAATTTTTAATGAGTTCTCAATGCAGTTTTACTGTTGAATAA
TGAATGACATTCTTAAATAAATTATATAACTGTTAATAAATAGTTTGAGAATTACAAATT
ATTTGAAGATAAATTGATCGAAGATATAAAAAGTGTTTAGTAGGAAGATGATAAAGATTG
CAGGGTATTTATTTAAATACTATTACTTTTGATATGTGTTTTAGATAATTAATTTAACAT
GGTTCTTTTTAAATATTAAAGGTACACGTTTGTCTCTATTTTATATAAGGAAGAAGCATT
TCTAAATTTGATTAAAAAGCTATTCTCAAACTTTAAGAACATGTTAGCATTATTCCTATC
TTAGCAAAAGGAGATACTTACATGATTGAAGAAGTGAAATAAATCAAGCAAAATATTATT
AAAGATGCACATGATAATAAAATAAGCTTTTTTGATTGTGAAGCAGTAATTAATATTTTA
TCATTTATCAAATTTAAAAATTATAATTTTAAATATTTTAAATACATTTTTACAAAAAAT
CATTAGCCCTTAAAGAACGATAAAGAAAGACTCTAAAAATTGAGGAATGGACCTTTTGGA
CATTCTCCACCATTCCTTATGATATCTTCTGTATAAAAAATAGAAATAGAAAAATAAAAA
ATATATGCAAGGTAACATAATCTAAACATTTATTTTTTTATTTCAAAATCATAAATAATC
TTAAAAAGTAAATGTGCTTGTTTAATATATACTTTTTTATTGATAGAAAATACCCTTGGG
GAATATGTAAAATAGAAGATCCAGAACATTCTGATTTCTTGCTTCTTTATCAACTTTTGA
TTGGATACTTCATCGCTGATCTTAAGAAACTAACTGATATTATCTACAAGCAATATTTGA
AAAAGAAGAAAAAATAAATAAAAGAAGAAAAGAAAAATAAATAGAATCAGAAATTAATTG
GAGGAGGTGTTGCCTTAGCCATAGCAGGATTACTTGGCTTTATCAAATATTAAGCCATTA
AATGA


>TTHERM_00316560(protein)
MDNQRVPFPTKATNNPNQFFSAFERNQNESGEQIFNRTFTRSIESSHWDNDNSNLLADLE
ELDQIKQKQADQRNSNKNDFSKLDKQYLNEMLQQQQKKIGNILEVSSPQKSSPQIPQKQE
NTFFPDQDLKFKKQTSQKRSALQGSFNMFHGKDDNRLGETLISEYVSEDFHSQHNSPLKE
LVITQTQVGGNNQNNPSYLHTNQNQNQLSVLISQQEDNAQSTSHVHNEQSVLSILKEHEL
EKPVYINVMVAGAQGLGKSTFIDAFLNKKFHKEQPDVIRPKTEEIVEVTGIRTENKIKLH
LNMIDTPGYSEETNIDEWIDKIIKHIVGKFENYKLFEDKLIEDIKSVQQEDDKDCRVHVC
LYFIQGRSISKFDQKAILKLQEHVSIIPILAKGDTYMIEEVKQIKQNIIKDAHDNKISFF
DCEAPLKNDKERLQKLRNGPFGHSPPFLMISSVQKIEIEKQKIYARKYPWGICKIEDPEH
SDFLLLYQLLIGYFIADLKKLTDIIYKQYLKKKKKQIKEEKKNKQNQKLIGGGVALAIAG
LLGFIKYQAIK