Identifiers and Description

Gene Model Identifier

TTHERM_00318700

Standard Name

CDK10 (Cyclin-Dependent Kinase 10)

Aliases

PreTt21071 | 31.m00373 | 3687.m00174

Description

cyclin-dependent kinase-like protein; Cell division control protein; sequence similarity to the CDC2 subfamily of the protein kinase CDK family

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08326.1 9.997093137033517e-262
Description: cell division control protein (322 aa)
Oxytricha Contig5189.0.g91 5.001686403916211e-109
Description: Protein kinase domain
DictyBase DDB_G0272813 4.999984259728227e-105
Description: cdk1 on chromosome: 2 position 2216835 to 2217926
WormBase WBGene00000405 1.9994050701445255e-104
Description: locus:cdk-1 Cyclin-dependent kinase 1 status:Confirmed UniProt:P34556 protein_id:CAA81590.1
SGD YBR160W 8.000542080162695e-100
Description: CDC28 Catalytic subunit of the main cell cycle cyclin-dependent kinase (CDK); alternately associates with G1 cyclins (CLNs) and G2/M cyclins (CLBs) which direct the CDK to specific substrates
Stentor Coeruleus SteCoe_11769 3.093350011308561e-50
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00318700(coding)
ATGTAAATGGATAATTAAGAGTAGAATTAAGTGGAGAAATTTATAGGAAAATATGAAGTA
TTGAATGTTATAGGTAAGGGAACTTATGGTGAAGTATTTAGAGCTAGGGACCAAGAAACA
CACGAAATAGTTGCTTTGAAAAAAACTATAACTAAGCTTGAAAATGATGGAATTCCAAGT
TCTGCTTTGAGAGAAATATCTTTGCTAAAAGAAATTAATCACGAAAACGTTGTAGTATTA
AAAGATATAATTATACAAAACAACTTGCTTTACCTTGTTTTCGAATTCTGTGAAAGCGAT
TTAAAGAAATTTTTAGATTCAAAGACTAAAGTAGCAGGATAATTCCTTGATGCCCTTACA
ATTAAAAAAATAGTTTATCAGATAATTAGAGGTGTTGCAGCTTGTCACACAAGGAGAATT
ATGCATAGAGATCTCAAGCCATAAAATATTTTGATTGATAAAAATGAAGTAGTAAAAATC
GCAGATTTTGGTTTATCTAGAACATTTTGCATGCCTATAAGACCTTACACAAAAGAAGTT
GTTACTTTATGGTACAGACCACCTGAAATTCTTTTAGGTGCATTGGACTACTGTACTCCC
ATAGACATGTGGTCAGTGGGTTGCATAATGTATGAATTAATTACAAGAGTGCCATTGTTT
TAAGGAGATTGTGAGATTGGATAAATATTTAAAATTTTCCAGATATTAGGAACACCTACA
GAAAATGACTGGCCTGGCATTAAGGACTTGACAGATTATAAACCTACATTCCCAAGATTC
AGACCTTAAAAGCTAAGTGAAATGATTGAAAACATATATAAAAAGTATAACTAAAACTCA
GAAGTTGATATAGCTGCTGTTGATTTGCTATAGAGACTTCTTTGCTATGATCCTATTAAA
AGAATAACTGCAAAGTCTGCTTTAAATCATCCTTATTTCTTTGATGTAAGAAATCTTTTT
GGACCAATTTGA


>TTHERM_00318700(gene)
ATGTAAATGGATAATTAAGAGTAGAATTAAGTGGAGAAATTTATAGGAAAATATGAAGTA
TTGAATGTTATAGGTAAGGGAACTTATGGTGAAGTATTTAGAGCTAGGGACCAAGAAACA
CACGAAATAGTTGCTTTGAAAAAAACTATAACTAAGGTAAAAAGTCATTAATTTTTTATC
TAAAATTTTATCTATTTATCTAAAATATTCTTAAATGATTTAAATATAAACAGCTTGAAA
ATGATGGAATTCCAAGTTCTGCTTTGAGAGAAATATCTTTGCTAAAAGAAATTAATCACG
AAAACGTTGTAGTGTAACTATTATTCATTAAAAATAATAAAAAATAATACTTTCTATTTA
TAGATTAAAAGATATAATTATACAAAACAACTTGCTTTACCTTGTTTTCGAATTCTGTGA
AAGCGATTTAAAGAAATTTTTAGATTCAAAGACTAAAGTAGCAGGATAATTCCTTGATGC
CCTTACAATTAAAGTAATTTTAATAGATAATGTTTTTGCTTTTTATTAAAAGTTATTTTA
AATTGTACTTATTTTATTGACAATCTAAATCTTATCAGTATTTAAACTTAATTTCAGAAA
ATAGTTTATCAGATAATTAGAGGTGTTGCAGCTTGTCACACAAGGAGAATTATGCATAGA
GATCTCAAGCCATAAAATATTTTGATTGATAAAAATGGTAAAATTGTTAATTATGCTTTG
AAATAAATTTCTGCAATTTTAGAAAATAAATTTGATTAATTTAATTTTTAATTTAAAATT
GAATTAATGGAGACCGTCGATTTAGACTTTTAAATTAAAAAAATTTATATCAACAAACTT
TTTTAAAAAAATTAGAAGTAGTAAAAATCGCAGATTTTGGTTTATCTAGAACATTTTGCA
TGCCTATAAGACCTTACACAAAAGAAGTTGTTACTTTATGGTACAGACCACCTGAAATTC
TTTTAGGTGCATTGGACTACTGTACTCCCATAGACATGTGGTCAGTGGGTTGCATAATGT
ATGAATTAATTACAAGAGTGCCATTGTTTTAAGGAGATTGTGAGATTGGATAAATATTTA
AAATTTTCCAGTAAAATTGAATTCATTTTAAATTACTTTACCTTCTATCTTAATTATCTT
TATTATTATATTAAAGGATATTAGGAACACCTACAGAAAATGACTGGCCTGGCATTAAGG
ACTTGACAGATTATAAACCTACATTCCCAAGATTCAGACCTTAAAAGCTAAGTGAAATGA
TTGAAAACATATATAAAAAGTATAACTAAAACTCAGAAGTTGATATAGCTGCTGTTGATT
TGCTATAGAGACTTCTTTGCTATGATCCTATTAAAAGAATAACTGCAAAGTCTGCTTTAA
ATCATGTAAGTTTTCAAAAATTTTTAAAGTAATTAAGCAGTAAACAAACAATTTTGATAT
AAAAAACAGCCTTATTTCTTTGATGTAAGAAATCTTTTTGGACCAATTTGA


>TTHERM_00318700(protein)
MQMDNQEQNQVEKFIGKYEVLNVIGKGTYGEVFRARDQETHEIVALKKTITKLENDGIPS
SALREISLLKEINHENVVVLKDIIIQNNLLYLVFEFCESDLKKFLDSKTKVAGQFLDALT
IKKIVYQIIRGVAACHTRRIMHRDLKPQNILIDKNEVVKIADFGLSRTFCMPIRPYTKEV
VTLWYRPPEILLGALDYCTPIDMWSVGCIMYELITRVPLFQGDCEIGQIFKIFQILGTPT
ENDWPGIKDLTDYKPTFPRFRPQKLSEMIENIYKKYNQNSEVDIAAVDLLQRLLCYDPIK
RITAKSALNHPYFFDVRNLFGPI