Identifiers and Description

Gene Model Identifier

TTHERM_00319990

Standard Name

p28B

Aliases

PreTt15918 | 32.m00162

Description

p28B 33 kDa inner dynein arm light chain axonemal protein; Light chain subunit of inner arm dynein (IAD) complex 2

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10117.1 3.0013161285558437e-171
Description: hypothetical protein (241 aa)
Oxytricha Contig10849.0.g14 2.998733531465523e-108
Description: Axonemal dynein light chain
Stentor Coeruleus SteCoe_23350 1.5007857627073948e-41
Description: None
WormBase WBGene00018307 9.9981864321491e-40
Description: locus:dyla-1 status:Partially_confirmed UniProt:Q95YA5 protein_id:CCD71054.1

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00319990(coding)
ATGTCTCGTTATCCAAGAGAATCATTAGTTTAATATGAACCTGAAACAGCCATTCATAAG
AATAGCGATATTGCAAGAATTTCAAGTTTAGGTAATAAAAAAAAGCATTAACTTCCTCCT
CTTGAGTCTAAGCCTTCTACTGATGATATATTGAATGCTATTTTACCTCCTAGAGAATGG
GATCACGAAGGAACCCATTACATTTAATATGTTTCTCACAATCCTGCTTCAAGAGAAGAT
GTTGCTAATTTATAAAAGACTTTGGATGAAAAATTATTGGCTAGACAAGCAAGAGATTCT
GGTATTTGCCCTATAAGAGAAGAACTCCATAGTTAGTGTTTTGATGAAATTATTAGACAA
GTTACAATTGACTGCCCAGAAAGAGGTATATTATTGTTGAGAGTTAGAGATGAATTAAAA
ATGACTATTGCTGCATACCAAACTTTATATCAATCATCTGTTACATTTGGTATGAGAAAG
TAATTATAGTCTGAATAAGGTAAAGCTGACACAGAATTAAAAATATCTGAACTAGAAAAG
AAGAAAGCAAAATTAGAAGAAAGAAGAGTAGAACTGCTAAACAAGAAAGAAGCTATAGAG
AAAAGAAATAAAGAAAGAAGAGATATCGAAGAATAAAAGAGAAAGTAAGAAATTGAATTC
TTAAAATATCAAAGTTAACATTTAGAATAGTTCCTTAAATCTGTTACTCCTGATCTTAAA
TGA


>TTHERM_00319990(gene)
ATGTCTCGTTATCCAAGAGAATCATTAGTTTAATATGAACCTGAAACAGCCATTCATAAG
AATAGCGATATTGCAAGAATTTCAAGTTTAGGTAATAAAAAAAAGCATTAACTTCCTCCT
CTTGAGTCTAAGCCTTCTACTGATGATATATTGAATGCTATTTTACCTCCTAGAGAATGG
GATCACGAAGGAACCCATTACATTTAATATGTTTCTCACAATCCTGCTTCAAGAGAAGAT
GTTGCTAATTTATAAAAGACTTTGGATGAAAAATTATTGGCTAGACAAGCAAGGTAATAA
TTAATTAGTTTTAGCATATTTGTCTTTTAAATTATTTGAATGTTTAAAATAGCACATTTT
TTAATTTTTAATCATCAAAAAACTTTTAAATTCAAAAATTAGAGATTCTGGTATTTGCCC
TATAAGAGAAGAACTCCATAGTTAGTGTTTTGATGAAATTATTAGACAAGTTACAATTGA
CTGCCCAGAAAGAGGTAAATTGATATTGTTCTTAACAAATAACATAAAGCAGTTAATAAA
AAAATTAATACTACAATATGCAACTGTCTAAATTAGTAAATTTATAAGTGAATTCAGTTG
AAAGAAAGGTTTAATAAGTTTTTAATGAATAATTTAATCTAAAATTTGTTTCAAAGTATT
AATTTGGATGTCTTAAAATTTTAGTAGATATATTGAGTTATTTAATATTGAGAAATGCTA
GTTATTACAAATTATTATGATGATTTTTATTAAAGAAAATGAACTGCTTTAAATTAAACA
TCAAAAACCTATTAAAATTTAATTGATATATTAATAATAAATATAAATAATAAAAGGTAT
ATTATTGTTGAGAGTTAGAGATGAATTAAAAATGACTATTGCTGCATACCAAACTTTATA
TCAATCATCTGTTACATTTGGTATGAGAAAGTAATTATAGTCTGAATAAGGTAAAGCTGA
CACAGAATTAAAAATATCTGAACTAGAAAAGAAGAAAGCAAAATTAGAAGAAAGAGTAAT
TATTTAGTTTTTCAATCTTCGTTTTTAATCGGCTTTTTTTGATAATTTAAATTTAGAGAG
TAGAACTGCTAAACAAGAAAGAAGCTATAGAGAAAAGAAATAAAGAAAGAAGAGATATCG
AAGAATAAAAGAGAAAGTAAGAAATTGAATTCTTAAAATATCAAAGTTAACATTTAGAAT
AGTTCCTTAAATCTGTTACTCCTGATCTTAAATGA


>TTHERM_00319990(protein)
MSRYPRESLVQYEPETAIHKNSDIARISSLGNKKKHQLPPLESKPSTDDILNAILPPREW
DHEGTHYIQYVSHNPASREDVANLQKTLDEKLLARQARDSGICPIREELHSQCFDEIIRQ
VTIDCPERGILLLRVRDELKMTIAAYQTLYQSSVTFGMRKQLQSEQGKADTELKISELEK
KKAKLEERRVELLNKKEAIEKRNKERRDIEEQKRKQEIEFLKYQSQHLEQFLKSVTPDLK