Identifiers and Description

Gene Model Identifier

TTHERM_00322760

Standard Name

KAT1 (KATanin 1 )

Aliases

PreTt15995 | 32.m00239

Description

KAT1 katanin p60 ATPase subunit A1; Katanin p60 catalytic subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00004 ) ATPase, AAA family
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF07724 ) ATPase family associated with various
  • ( PF07728 ) ATPase family associated with various
  • ( PF09336 ) Vps4 C terminal oligomerisation domain
  • ( TIGR00179 ) UDP-N-acetylenolpyruvoylglucosamine reductase
  • ( TIGR01241 ) ATP-dependent metallopeptidase HflB
  • ( TIGR01242 ) 26S proteasome subunit P45 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10067.1 9.997093137033517e-262
Description: ATPase, AAA family protein (648 aa)
Oxytricha Contig7897.0.0.g35 2.0004037638327014e-151
Description: ATPase family associated with various cellular activities (AAA)
WormBase WBGene00003183 1.9993206333383003e-80
Description: locus:mei-1 Meiotic spindle formation protein mei-1 status:Confirmed UniProt:P34808 protein_id:CAB00052.1
SGD YPR173C 1.0004671766404936e-76
Description: VPS4 AAA-ATPase involved in multivesicular body (MVB) protein sorting, ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane release; ATPase activity is activated by Vta1p; regulates cellular sterol metabolism
DictyBase DDB_G0268334 4.000989088096131e-71
Description: DDB_G0268334 on chromosome: 1 position 714031 to 716367
Stentor Coeruleus SteCoe_28576 1.7785284761271306e-68
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:27726198: Waclawek E, Joachimiak E, Hall MH, Fabczak H, Wloga D (2017) Regulation of katanin activity in the ciliate Tetrahymena thermophila. Molecular microbiology 103(1):134-150
  2. Ref:17821280: Harrison JA, Fowler EH (1945) AN ANTIGEN-ANTIBODY REACTION WITH TETRAHYMENA WHICH RESULTS IN DYSTOMY. Science (New York, N.Y.) 102(2638):65-6

Sequences

>TTHERM_00322760(coding)
ATGTCAAATTCAGATAAACAATTAGAAGATCTTAAAAATTACATCAGTTTAGCGAGAGAA
AGCGCATATTTCGGCAAGTATTCTGAAGCAATTAACACTTTTAAAAAGGGCTTAGAAGTT
GCTGGCATGTTCAAGGTAAAGGCTGTAGAATAATATGCTTAGTAGGTATGGGAAAAATTT
GTGCTAGACTTATAAGCAGAATTCGATATAATCTCTTAATTGCAAGCAGTTAACCACGGA
TTTAAACCTCAACCACCTAATGGAGCAAACAAATAAGCTAATAATTAGAATGGTTAATAA
GGATAATAATAAAATTAACTCGATCATGATAAAAAATATCCTTTTGGTATTAAACCTTTT
TCTCACTTCGAAGATAACAAAATGAACAATAACAATAATAACAATAATAATAATAATAAT
AATAATAATCCTTTTAGATAGCAAGATAAGAATTTCTTACACAATTAACAATACTAAAAC
AATTTACCTGATCAAAATATGCACAATAACTAAAACTACAATAACTTTTAAGCACCTCAT
CAATACAATATGAATAGATAAGGTGGACCTGGAATGTAAGGAAATTATGGTTAAAACAAT
TATCAAAGTAATAACCCTAGCAACTATGGATATAATGACTTTTAGGATAATCCCTCATAA
AATTTTAATAGCCCTAATATTGAATACAATTAAAGATAAAATAGAAACCCTGCCAATAAT
GATTAAGGTAATTAAGATCCTGACGTTTGGCCAGCTCCTCCTCCTAAAGTCAACAAAGCC
AATAAAGCCCCTTAGAAGAATAAAACCCCTATTTACAATTTAAAAGAACTTCAGTAAAAG
CAAAATGATAATAATAATAACAATAATGCTAAAAAAGATGATAAAGAAAAGGCTAAAAGA
GATTACAATAAACCATGGTAAAGAAATGCTTAGACTCCTCAAGCAAAGAAAAAAGGTGAT
GAAGGAGAGAAAAAATAAAGCTTCTTAAATTTTTGTTATCCAAACGGATAAGGTCCTGAT
TCCGATTTGATAGCAATGCTTGAAAGAGATGTAGTAGATTAAAATCCTAATATCAGCTTT
GACTAAATCGCAGAGCTTGATAAAGCTAAAGATATGCTTTAAGAGGCTGTTTTGCTTCCT
ATTCTGATCCCTTAATATTTTAGAGGTATTCGTAGACCTCTTAAAGGAGTTCTTATGTTT
GGTCCTCCTGGTACTGGTAAAACCATGTTAGCAAAAGCTGTAGCAACAACTGGTAAAACC
ACATTCTTTAATGTTTCTGCCAGTAGTTTGGCTTCAAAGTGGAGAGGTGATTCAGAGAAA
CTAGTCAGAATTCTTTTCGAGATGGCAAGGTACTATGCACCTAGTACTATATTTTTCGAT
GAGATAGATGCTATTGGTTCTAAAAGAGTAGATGGAGAGTGCGAAGCAAATAGAAAAATG
AAAGCTGAAATGCTCATTTAAATTGATGGTGTAAGCAGCTCTTCAACAGATGAAAAAGAT
AGAAAATAAGTTATGGTCTTGGCAGCCACTAATAGACCTTGGGATTTAGATGAAGCTTTA
AGAAGAAGACTCGAAAAAAGAATTTTAATTCCTTTACCTTCCACTGAAGGCAGAAAGCAA
TTATTTGAGTTGAATATGAGAGGTATTAAATGCTCGGATGACATAGACTGGGTTGAATTA
GTTGGTAAAACTGATGGTTATTCAGGTGCTGATATAGCAAGTCTTTGCAGAGAAGCAGCT
TTTATGCCTATGAGAAGAAAATTAATGAAAGAAGGTGGTTTTAAAAATATTGAAAACATA
GAAAATCTTGCCTAGGAAAGTGACATACCGTTAACATAAAAAGATTTCGAAGAAGCTTTA
AGAAATGTAAATAAATCAGTAAGCAACGATGATCTAGAAAATTTTGAAAAATGGATGGCA
GAATTTGGTTCTGTTTGA


>TTHERM_00322760(gene)
ATGTCAAATTCAGATAAACAATTAGAAGATCTTAAAAATTACATCAGTTTAGCGAGGTAA
ATTTGTTTTTTAATCATTTGAATAAAATTATTATATGTAGAATACCCATCAGCATATTAA
CTAATTCTATTATTAATTATTAGAGAAAGCGCATATTTCGGCAAGTATTCTGAAGCAATT
AACACTTTTAAAAAGGGCTTAGAAGTTGCTGGCATGTAAATAGATTGCTTCAATATTGAA
ATTTAATATTACAAAACTTTCTTATGAAAATTAAGACTTGTTTGGTTAAAAAATATATCA
TTTTATCCAGAATAATTGATTTGCGATAAACAATATATATTTTTGTTTTTTTAAATAAAG
GTTCAAGGTAAAGGCTGTAGAATAATATGCTTAGTAGGTATGGGAAAAATTTGTGCTAGA
CTTATAAGCAGAATTCGATATAATCTCTTAATTGCAAGCAGTTAACCACGGATTTAAAGT
AAGCTTTATTCAATTTATGAGCATTAATAGAATCATTTTTTTGAATTAATTTATAAAGCC
TCAACCACCTAATGGAGCAAACAAATAAGCTAATAATTAGAATGGTTAATAAGGATAATA
ATAAAATTAACTCGATCATGATAAAAAATATCCTTTTGGTATTAAACCTTTTTCTCACTT
CGAAGATAACAAAATGAACAATAACAATAATAACAATAATAATAATAATAATAATAATAA
TCCTTTTAGATAGCAAGATAAGAATTTCTTACACAATTAACAATACTAAAACAATTTACC
TGATCAAAATATGCACAATAACTAAAACTACAATAACTTTTAAGCACCTCATCAATACAA
TATGAATAGATAAGGTGGACCTGGAATGTAAGGAAATTATGGTTAAAACAATTATCAAAG
TAATAACCCTAGCAACTATGGATATAATGACTTTTAGGATAATCCCTCATAAAATTTTAA
TAGCCCTAATATTGAATACAATTAAAGATAAAATAGAAACCCTGCCAATAATGATTAAGG
TAATTAAGATCCTGACGTTTGGCCAGCTCCTCCTCCTAAAGTCAACAAAGCCAATAAAGC
CCCTTAGAAGAATAAAACCCCTATTTACAATTTAAAAGAACTTCAGTAAAAGCAAAATGA
TAATAATAATAACAATAATGCTAAAAAAGATGATAAAGAAAAGGCTAAAAGAGATTACAA
TAAACCATGGTAAAGAAATGCTTAGACTCCTCAAGCAAAGAAAAAAGGTGATGAAGGAGA
GAAAAAATAAAGCTTCTTAAATTTTTGTTATCCAAACGGATAAGGTCCTGATTCCGATTT
GATAGCAATGCTTGAAAGAGATGTAGTAGATTAAAATCCTAATATCAGCTTTGACTAAAT
CGCAGAGCTTGATAAAGCTAAAGATATGCTTTAAGAGGCTGTTTTGCTTCCTATTCTGAT
CCCTTAATATTTTAGAGGTATTCGTAGACCTCTTAAAGGAGTTCTTATGTTTGGTCCTCC
TGGTACTGGTAAAACCATGTTAGCAAAAGCTGTAGCAACAGTAAGTTTTTTTAAAAATTA
TATAAAAATATTTTTTAAAAATAAATCTCAAAGAAAAAACATAAATTTTACATAAGAAAG
AAAGAATCATTTTAATATAAAAGTATAAATTTACTTTAAATATAAATAAAATGCCTAATT
TTTAAATTAAGTTTCTGGAATAAAAAAATAGAACTTTTATTTTTAATTTGTCTTTAAACA
AGCTCGCTCTAGAATTTTATTAATTTTGATTCTTGGCTCGTTCATTATCTAAAAATAAAT
TTACTAAATTTATTTTAGAAATTTTCTTTTATTTTACTTTTGAAAATATTTTTTGAACTA
AAAAAAAATATTTTTGTTTTTACAAATTTTAATTTCAAAATTATTTTTTTTCATTTAAAA
AAAGACTGGTAAAACCACATTCTTTAATGTTTCTGCCAGTAGTTTGGCTTCAAAGTGGAG
AGGTGATTCAGAGAAACTAGTCAGAGTAAATTTCTCTATAACAAACTTTAATAAATAGGA
TTAATTTATTAATTCATTATTTAATTAGATTCTTTTCGAGATGGCAAGGTACTATGCACC
TAGTACTATATTTTTCGATGAGATAGATGCTATTGGTTCTAAAAGAGTAGATGGAGAGTG
CGAAGCAAATAGAAAGTAAAAATTTAAATTTAAACTAATCTATATTTCTTAAACAAACAA
CTATGATAATAATTATATCTAAAATTAAGAATGAAAGCTGAAATGCTCATTTAAATTGAT
GGTGTAAGCAGCTCTTCAACAGATGAAAAAGATAGAAAATAAGTTATGGTCTTGGCAGCC
ACTAATAGACCTTGGGATTTAGATGAAGCTTTAAGAAGAAGACTCGAAAAAAGAATTTGT
AATTCGAATAAAAAAGTGTAAATAAAAATAGTAATATATTTTTTAATCTATAAATAGTAA
TTCCTTTACCTTCCACTGAAGGCAGAAAGCAATTATTTGAGTTGAATATGAGAGGTATTA
AATGCTCGGATGACATAGACTGGGTTGAATTAGTTGGTAAAACTGATGGTTATTCAGGTG
CTGATATAGCAAGTGTAATTTATTTTTCATTTTTATTCTAAATTTAGCACAATTTCTTAT
GATTAAAATAGCTTTGCAGAGAAGCAGCTTTTATGCCTATGAGAAGAAAATTAATGAAAG
AAGGTGGTTTTAAAAATATTGAAAACATAGAAAATCTTGCCTGTAAGATTTTTATATTTA
AAAACTACATTAATATTGAAATTTTTTTTAAATAAAGAGGAAAGTGACATACCGTTAACA
TAAAAAGATTTCGAAGAAGCTTTAAGAAATGTAAATAAATCAGTAAGCAACGATGATCTA
GAAAATTTTGAAAAATGGATGGCAGAATTTGGTTCTGTTTGA


>TTHERM_00322760(protein)
MSNSDKQLEDLKNYISLARESAYFGKYSEAINTFKKGLEVAGMFKVKAVEQYAQQVWEKF
VLDLQAEFDIISQLQAVNHGFKPQPPNGANKQANNQNGQQGQQQNQLDHDKKYPFGIKPF
SHFEDNKMNNNNNNNNNNNNNNNPFRQQDKNFLHNQQYQNNLPDQNMHNNQNYNNFQAPH
QYNMNRQGGPGMQGNYGQNNYQSNNPSNYGYNDFQDNPSQNFNSPNIEYNQRQNRNPANN
DQGNQDPDVWPAPPPKVNKANKAPQKNKTPIYNLKELQQKQNDNNNNNNAKKDDKEKAKR
DYNKPWQRNAQTPQAKKKGDEGEKKQSFLNFCYPNGQGPDSDLIAMLERDVVDQNPNISF
DQIAELDKAKDMLQEAVLLPILIPQYFRGIRRPLKGVLMFGPPGTGKTMLAKAVATTGKT
TFFNVSASSLASKWRGDSEKLVRILFEMARYYAPSTIFFDEIDAIGSKRVDGECEANRKM
KAEMLIQIDGVSSSSTDEKDRKQVMVLAATNRPWDLDEALRRRLEKRILIPLPSTEGRKQ
LFELNMRGIKCSDDIDWVELVGKTDGYSGADIASLCREAAFMPMRRKLMKEGGFKNIENI
ENLAQESDIPLTQKDFEEALRNVNKSVSNDDLENFEKWMAEFGSV