Identifiers and Description

Gene Model Identifier

TTHERM_00324550

Standard Name

MRNN04 (Membrane Occupation and Recognition Nexus protein N-terminal)

Aliases

PreTt16060 | 32.m00304

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10022.1 7.001733352475241e-137
Description: hypothetical protein (197 aa)
Oxytricha Contig6382.0.g24 7.996716697404228e-65
Description: MORN repeat
Stentor Coeruleus SteCoe_26732 1.185064864233981e-27
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00324550(coding)
ATGTTAAACAAATAACAAAAGTAATCAATTTGGTCAGGTAGTGTTTATGAAGGGGACATG
AAAGATGGATGGTATCACGGAAAAGGAAAATTCAAATACCCTAATGGAGTAATTTATGAA
GGAGATTTTGTTAAAGGTCAATTTCATGGAGAAGGAATATTGATATATCCAAATGGTGGT
AAATATAAAGCACATTGGGAACATGGCAAAATGATTAAGGGCGATTATTACTTTTAAGAT
AATTTAAAATACGAATCAGAATAATGGAATTATTGCTAGGGTGAAGACAGAAGATTCTAT
CCTGAAATGTTAAATGGTATTAAACCTGCAGGTGCTACTTAAATGACAAAAGAAGAAAAA
GCACCACATGACATACCTGAAGGGACTTATGATGTTGGTGAAGGTTATTATGAGCCTATA
AAATCTATTATATATGAATATGATGGTAAGATACTTAGAACTCCAAGTGAGGCAGAAGTA
GAAAACATTCTTAAAAAGTGCAGATATAACCCAAGAAAATCATTAGTTATAACAGGAGAA
AACGATAAGATTATTAAAAGTGTAACAGATCCTTCAAAATAAAATAAAATTTGA


>TTHERM_00324550(gene)
ATGTTAAACAAATAACAAAAGTAATCAATTTGGTCAGGTAGTGTTTATGAAGGGGACATG
AAAGATGGATGGTATCACGGAAAAGGTAAAAAAATGAGCTATTCTTTTCATATAAAAGCA
AAGATTTTCTCTGAAAATAGAAGATTATTTTAAATTTAACGAAAAATATTTATTAAATCT
AAATTATTTTTACTCTGTGATTAGGAAAATTCAAATACCCTAATGGAGTAATTTATGAAG
GAGATTTTGTTAAAGGTCAATTTCATGGAGAAGGAATATTGATATGTAGCTTTGATTTAT
CTTTCAAATGATTACTGTATAATTTTATTTTTCAAAGATCCAAATGGTGGTAAATATAAA
GCACATTGGGAACATGGCAAAATGATTAAGGGCGATTATTACTTTTAAGATAATTTAAAA
TACGAATCAGAATAATGGAATTATTGCTAGGGTGAAGACAGAAGATTCTATCCTGAAATG
TTAAATGGTATTAAACCTGCAGGTGCTACTTAAATGACAAAAGAAGAAAAAGCACCACAT
GACATACCTGAAGGGACTTATGGTAATTAAAACAATAAATTTACATATAATTTTACAAAT
AATATATTTCTCTACTCTATTTTTAGTATTTAGGTTTGATTATTTTAAGAGTATTTAAAA
ATTGAAGCTTAAATATTAAGTTATTTCTACTTTTTATTACATTTATTTTTTTAATGAAAA
CTAATTTATGAATAATCAATCAAAAATGATTAATTTATTTAATAGATGTTGGTGAAGGTT
ATTATGAGCCTATAAAATCTATTATATATGAATATGATGGTAAGATACTTAGAACTCCAA
GTGAGGCAGAAGTAAATTAGTTTAAAATTATTTTGAGCAAAATTAATTTGAAGTTGAATA
AATAACAAAGGTAGAAAACATTCTTAAAAAGTGCAGATATAACCCAAGAAAATCATTAGT
TATAACAGGAGAAAACGATAAGATTATTAAAAGTGTAACAGATCCTTCAAAATAAAATAA
AATTTGA


>TTHERM_00324550(protein)
MLNKQQKQSIWSGSVYEGDMKDGWYHGKGKFKYPNGVIYEGDFVKGQFHGEGILIYPNGG
KYKAHWEHGKMIKGDYYFQDNLKYESEQWNYCQGEDRRFYPEMLNGIKPAGATQMTKEEK
APHDIPEGTYDVGEGYYEPIKSIIYEYDGKILRTPSEAEVENILKKCRYNPRKSLVITGE
NDKIIKSVTDPSKQNKI