Identifiers and Description

Gene Model Identifier

TTHERM_00327340

Standard Name

CDC16 (Cell Division Cycle 16)

Aliases

PreTt30237 | 33.m00249 | 3705.m00077

Description

CDC16 tetratricopeptide repeat protein; TPR domain containing protein; subunit of anaphase promoting complex

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00515 ) tetratricopeptide repeat
  • ( PF01239 ) Protein prenyltransferase alpha subunit repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF07721 ) Tetratricopeptide repeat
  • ( PF08238 ) Sel1 repeat
  • ( TIGR00213 ) D,D-heptose 1,7-bisphosphate phosphatase
  • ( TIGR00990 ) mitochondrial precursor proteins import receptor
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein
  • ( TIGR02552 ) type III secretion low calcium

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08574.1 9.997093137033517e-262
Description: TPR Domain containing protein (867 aa)
Oxytricha Contig17304.0.g24 6.99920276797163e-121
Description: TPR repeat
SGD YKL022C 6.998316056150599e-49
Description: CDC16 Subunit of the anaphase-promoting complex/cyclosome (APC/C), which is a ubiquitin-protein ligase required for degradation of anaphase inhibitors, including mitotic cyclins, during the metaphase/anaphase transition; required for sporulation
DictyBase DDB_G0286233 3.000555717977434e-27
Description: anapc6 on chromosome: 4 position 4222260 to 4225138
WormBase WBGene00001281 1.9994498063102785e-22
Description: locus:emb-27 status:Confirmed UniProt:G5EG38 protein_id:CAA88313.1
Stentor Coeruleus SteCoe_10424 0.00000001522997974471263
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00327340(coding)
ATGTCATAATCTAGCGGATAGAAACCAACAAGCATAGGATTATAGCAAGGTTAGCAGTAG
CAATATCCATAGTAAAGTTAATCAGTTAATTCGTAGTAGTCTTCGATTTTTTCAGGTTTG
CAAGCAGGATCAAGCGCTTCTCCTTCAATAAATAATTTCTTTACTTCTTCAAACATTCAT
AACATAGGATAAATCTAAAATGCAGGTACTTAGTAATAAGCTCAAGTCCAACAAAGTTCA
AATAACTTAATTGGTACGAGTTAAATTCCTAATACAATTCCTGCATCTTAAGTTCCTATT
AATCGCTTTGGGAGAGGCAGTTTCCGTCGTGGGGACAAAGAGTCAAAAACGTATTTGCAA
GAAATTTATGGACCATACTATTTGAATTGTGAATAAAATATTGAGGAAATAAAGGCAACA
GGAAGTGTTTTAGGAAATTCAGGTATTTCTGTCAATTATGGATAGCAAATCTAGTAAAAA
TTGTTTTAAGAGTGCTTAGAAAATGAGAATATTTGGAAACTCTATGAACTAGTAATTGAA
AATAAGTCTATGCATTCATGGACAGACGCAATTTTTTATGCTGATAAATTAATCACCTTA
ACTGATGGACTAGCACCTTTTGTATATTTACTTGGAGAATGCTATTTCTTAAATGGAGAT
TATAAAAAGGTCCATTCTCTTTTTGCTAAATATAAATTAATTAGCTATAATTCTCATTTT
ACGATACTTGCTGCTAAAGCATTATACAAAAATAAATAGTATGAATAATGCTTAAATTTA
CTTGAATAAGCTTAGGAGCAGTAAGTAGCTTCCTTAGCATAGCAAGGCCCTTCTTCTTTC
AATTACTAAGGCTCAACTTCTGCTTAGGGTATTCCTGTTGGATCTAACTTAAATAATCCA
AATTAAGGTTTAGGTGCAAGTACTTTTGGATAGCAATAAGTTGGAGGCCAGCAATTTAAC
AATATTCATCAATAGTTTGGACATAATTTGCATCATAGCCAGAATACTTTCCTTCACTAA
CAATAATAAAATCAGTCATAGCAATAATAGATGAAAAATTAGAATAAGTTAGAAGCTTAA
AAGCATCTATTAAAGGGATTGTGTTATGAAGCAAGCGAAAATAAATAAAACGCAGTTAGT
TCTTACATGGAATGCCTAAAGCGCGATCCAACTTGTCATGAAGCTTTCAAAAGAATGATA
GATTTTTATTTATTAGGATCAACTGGTAAAGAATAACTCCTTACTTCTTTGAATTTCAAT
CCTGAAGATATTTGGATAAAATAATATTATATAGCTAGAATCAGTGAAGATACTGCTTGT
AAATTAGATATTTAAAAAGGAATGGATGAAGAGTTACCATCATCAGTAATAGGAAGCGAT
AAATCAGAAGTGATCATGAAGGATCCTAGTGGTGCAGGTATTGGAGGAGTAACAGTTCCT
GGAAATGTCAACAATGACCCCAAAGCTTAAATTAGAATTTAAAATTTATTGGAAAGATTA
AGACCTGAAAATTTATTTGAAACCTTGTCTTAAAAGAATAATATTGATTTACTTTGCATT
AAAGCAAAAAATTGTCATGCTAAGTATGATATTTAAAAAGCCTATGATATATGCATAAAA
GCAATTAAAATTGATCCATTATATTTTGACATAATACCTGTATATTGCGCTTGTTTACTT
CATCTCAACTATCTGGGTGAATTGTACTACTGTGCCCACAATCTAGTAGAAAATTACTCA
ACACATCCATTAAGTTGGTTTGCTATTGGTACTTATTATTATTTGACTAAAAAATATGAA
GTAGCAAGAAAGTATTTCTAAAAAGCTATCTATTTGGATAGAAATTTTGTTTATGCATGG
ATTGGTATGGCTCACTCTTTTGCAATTTAAGACGAGTCTGACTAAGCTATGAGCTTTTAC
AGAACTGTAAGCAGACTCTTCCCAGGTTGCTATTTAGCTCACTTGTACATGGGTATGGAA
TACTTAAGAACTAATAACCTTAAAACAGCTCTACTTTCCTTCTAATATGCAAAAGAAATC
AACAGTAATGATCCTCTTATTTACAACGAAATAGGTGTAATCTATTTTAAGTAGAAAGCC
TATGAAGAAGCAAAGCAAAAGTACTTGCAAGCTATGAATTTGTGTACTGAAGCAACTAAT
TCGATAGTTCATACCATTTTAAACAATCTGGCTCATACCTGTAGAAAAATGAAAGATTAT
AAATCTGCTATTTAATATTATGAAAGATGCATTCAGTTAGAGCCTAAAAATTATCAAACA
TATTTTTCTTTGGCATACACTTATCATATATCAAACCAATTGAATAAAGCTATAGCTTAT
TATCATAAATCTTTATATTACAAGCATGAAAACCAATTTGCTTTTGACATGCTTGATAGA
TGCCTTAAAGATGCTTCAGAGTATCCTTGGGAAAGTGTATACGAAGCTAAAAATGAATGA


>TTHERM_00327340(gene)
ATGTCATAATCTAGCGGATAGAAACCAACAAGCATAGGATTATAGCAAGGTTAGCAGTAG
CAATATCCATAGTAAAGTTAATCAGTTAATTCGTAGTAGTCTTCGATTTTTTCAGGTTTG
CAAGCAGGATCAAGCGCTTCTCCTTCAATAAATAATTTCTTTACTTCTTCAAACATTCAT
AACATAGGATAAATCTAAAATGCAGGTACTTAGTAATAAGCTCAAGTCCAACAAAGTTCA
AATAACTTAATTGGTACGAGTTAAATTCCTAATACAATTCCTGCATCTTAAGTTCCTATT
AATCGCTTTGGGAGAGGCAGTTTCCGTCGTGGGGACAAAGAGTCAAAAACGTATTTGCAA
GAAATTTATGGACCATACTATTTGAATTGTGAATAAAATATTGAGGAAATAAAGGCAACA
GGAAGTGTTTTAGGAAATTCAGGTATTTCTGTCAATTATGGATAGCAAATCTAGTAAAAA
TTGTTTTAAGAGTGCTTAGAAAATGAGAATATTTGGAAACTCTATGAACTAGTAATTGAA
AATAAGTCTATGCATTCATGGACAGACGCAATTTTTTATGCTGATAAATTAATCACCTTA
ACTGATGGACTAGCACCTTTTGTATATTTACTTGGAGAATGCTATTTCTTAAATGGAGAT
TATAAAAAGGTCCATTCTCTTTTTGCTAAATATAAATTAATTAGCTATAATTCTCATTTT
ACGATACTTGCTGCTAAAGCATTATACAAAAATAAATAGTATGAATAATGCTTAAATTTA
CTTGAATAAGCTTAGGAGCAGTAAGTAGCTTCCTTAGCATAGCAAGGCCCTTCTTCTTTC
AATTACTAAGGCTCAACTTCTGCTTAGGGTATTCCTGTTGGATCTAACTTAAATAATCCA
AATTAAGGTTTAGGTGCAAGTACTTTTGGATAGCAATAAGTTGGAGGCCAGCAATTTAAC
AATATTCATCAATAGTTTGGACATAATTTGCATCATAGCCAGAATACTTTCCTTCACTAA
CAATAATAAAATCAGTCATAGCAATAATAGATGAAAAATTAGAATAAGTTAGAAGCTTAA
AAGCATCTATTAAAGGGATTGTGTTATGAAGCAAGCGAAAATAAATAAAACGCAGTTAGT
TCTTACATGGAATGCCTAAAGCGCGATCCAACTTGTCATGAAGCTTTCAAAAGAATGATA
GATTTTTATTTATTAGGATCAACTGGTAAAGAATAACTCCTTACTTCTTTGAATTTCAAT
CCTGAAGATATTTGGATAAAATAATATTATATAGCTAGAATCAGTGAAGATACTGCTTGT
AAATTAGATATTTAAAAAGGAATGGATGAAGAGTTACCATCATCAGTAATAGGAAGCGAT
AAATCAGAAGTGATCATGAAGGATCCTAGTGGTGCAGGTATTGGAGGAGTAACAGTTCCT
GGAAATGTCAACAATGACCCCAAAGCTTAAATTAGAATTTAAAATTTATTGGAAAGATTA
AGACCTGAAAATTTATTTGAAACCTTGTCTTAAAAGAATAATATTGATTTACTTTGCATT
AAAGCAAAAAATTGTCATGCTAAGTATGATATTTAAAAAGCCTATGATATATGCATAAAA
GCAATTAAAATTGATCCATTATATTTTGACATAATACCTGTATATTGCGCTTGTTTACTT
CATCTCAACTATCTGGGTGAATTGTACTACTGTGCCCACAATCTAGTAGAAAATTACTCA
ACACATCCATTAAGTTGGTTTGCTATTGGTACTTATTATTATTTGACTAAAAAATATGAA
GTAGCAAGAAAGTATTTCTAAAAAGTAAATTTTATTTATTAGCTTATAATTTAAATGAAT
AGATTTATTTTTTAAGCTTCAATTAAATAGATTCTGCATTTTAACAAAAATTAAACCTTG
CATTTTTTACTAAAAAAGCTTAAATTATTAATTTAAAAAGTCTTAGTATTTTAAAATTTT
TAAATTAGCAATATAAATTAATACTTTTGGCATTTTAGGCTAATATTTTATAATTAATGG
CCAAAAGAAAGACATCTTAAATTAACAAAATTTTTTTTATTTAACCTGGAATTAAAAATT
TAATAGCTCAATATTTAAGAATAGCTATGAAAACTAATTCATAAAAATTTTTTTAAAGCT
TAATTATTGCTAGCTTAATATAATATCCTGAAATCTTCTTTTTTTTTATAATAAATTAAC
TTGAGATAGCTAATAATTTAAATTCCTAGGTTATTATTATCAATAAATGAGATGACTAAA
GTTGAAAATTTGAATTAGAAAATTTATTATTACCAGTAAAAAAATTAATGAAAATTTTTA
ATATTTTTAATATTATTATGATATACAAAATAATTATTTTTATTTACTACTAATTTTAAG
ATTATTGAATCATAAAAATTTTATTTTTTATTATTTTAGAATTTATTTTATTTTAATAGA
TATTTTTTAAGAAATAGAGAATAAAATTAAATAATGAAAAGATTAAATAAATATTTTTCA
ATAATTTAAAACAAAATTAGTAAGAGATAAATAAAAAATAAGTTTACATATTTAATTTGT
ATTTCTTGCCCATTAGAAATAAAATTGACTAGATTTAATGATTTATGAGATAGAATAGGC
ATATTATTTTAATATTAATTTTATATTACCTTTAAAATTAAAAAATATTTCTACAATTAG
CTTTTAATAAAAGAAAAATAAACGTAAACAGAGATTTTATTTCTTTTCTATACTTTTTTT
AATTTCTTCATTATCTTTGCTTGAAAGAAAATAGGAATTTTTTTTAAATTGATTCTCCTT
TGAATGCAATAACGAAACAAAATTATTTTTTTATAATCAAGATGATAATTTTAATTTTTT
ATAACCTTTCTTTTATAAAAAGGCTATCTATTTGGATAGAAATTTTGTTTATGCATGGAT
TGGTATGGCTCACTCTTTTGCAATTTAAGACGAGTCTGACTAAGCTATGAGCTTTTACAG
AACTGTAAGCAGACTCTTCCCAGGTTGCTATTTAGCTCACTTGTACATGGGTATGGAATA
CTTAAGAACTAATAACCTTAAAACAGCTCTACTTTCCTTCTAATATGCAAAAGAAATCAA
CAGTAATGATCCTCTTATTTACAACGAAATAGGTAAAATTAAAAAAATCAATGAAATATT
AAAATTTCAAATTCAAAAATAAAGACAATTAATTTTGATCATTCAATTTTTTATTACTTA
ATTAATTTTCTCAAAATTAATTAAACCTTTGGAATTCGATCAAATTTAGTATTTTAATAA
TTTCAATTCAATTAATCCATTATTTTTGAGATCGAATATAAATTTTTTAACAATGAATTT
ATTTTTGGTTTTTAATAGTCTACAGAATACTAAAACATTTAGATTACTTTGAATATGTAA
CTTAATAAAAGTGAATTTGATAATAATTATTTATCCTTTTTAATGTTTCTATTAAAAAAA
GAAAATATCTTATTTTTTCTTTTAAATTAAAGGTGTAATCTATTTTAAGTAGAAAGCCTA
TGAAGAAGCAAAGCAAAAGTACTTGCAAGCTATGAATTTGTGTACTGAAGCAACTAATTC
GATAGTTCATACCATTTTAAACAATCTGGCTCATACCTGTAGAAAAATGAAAGATTATAA
ATCTGCTATTTAATATTATGAAAGATGCATTCAGTTAGAGCCTAAAAATTATCAAACATA
TTTTTCTTTGGCATACACTTATCATATATCAAACCAATTGAATAAAGCTATAGCTTATTA
TCATAAATCTTTATATTACAAGCATGAAAACCAATTTGCTTTTGACATGCTTGATAGATG
CCTTAAAGATGCTTCAGAGTATCCTTGGGAAAGTGTATACGAAGCTAAAAATGAATGA


>TTHERM_00327340(protein)
MSQSSGQKPTSIGLQQGQQQQYPQQSQSVNSQQSSIFSGLQAGSSASPSINNFFTSSNIH
NIGQIQNAGTQQQAQVQQSSNNLIGTSQIPNTIPASQVPINRFGRGSFRRGDKESKTYLQ
EIYGPYYLNCEQNIEEIKATGSVLGNSGISVNYGQQIQQKLFQECLENENIWKLYELVIE
NKSMHSWTDAIFYADKLITLTDGLAPFVYLLGECYFLNGDYKKVHSLFAKYKLISYNSHF
TILAAKALYKNKQYEQCLNLLEQAQEQQVASLAQQGPSSFNYQGSTSAQGIPVGSNLNNP
NQGLGASTFGQQQVGGQQFNNIHQQFGHNLHHSQNTFLHQQQQNQSQQQQMKNQNKLEAQ
KHLLKGLCYEASENKQNAVSSYMECLKRDPTCHEAFKRMIDFYLLGSTGKEQLLTSLNFN
PEDIWIKQYYIARISEDTACKLDIQKGMDEELPSSVIGSDKSEVIMKDPSGAGIGGVTVP
GNVNNDPKAQIRIQNLLERLRPENLFETLSQKNNIDLLCIKAKNCHAKYDIQKAYDICIK
AIKIDPLYFDIIPVYCACLLHLNYLGELYYCAHNLVENYSTHPLSWFAIGTYYYLTKKYE
VARKYFQKAIYLDRNFVYAWIGMAHSFAIQDESDQAMSFYRTVSRLFPGCYLAHLYMGME
YLRTNNLKTALLSFQYAKEINSNDPLIYNEIGVIYFKQKAYEEAKQKYLQAMNLCTEATN
SIVHTILNNLAHTCRKMKDYKSAIQYYERCIQLEPKNYQTYFSLAYTYHISNQLNKAIAY
YHKSLYYKHENQFAFDMLDRCLKDASEYPWESVYEAKNE