Identifiers and Description

Gene Model Identifier

TTHERM_00328570

Standard Name

PET1 (E3 ubiquitin ligase)

Aliases

PreTt30261 | 33.m00273 | 3705.m00100

Description

PET1 RING-H2 zinc finger protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_40954.1 2.999180586171967e-98
Description: hypothetical protein (1035 aa)
WormBase WBGene00007226 0.0000000020002373268528243
Description: status:Confirmed UniProt:Q17573 protein_id:CAA84635.1
Oxytricha Contig3298.0.g70 0.000000030002053728821195
Description: Ring finger domain
DictyBase DDB_G0284807 0.000009999254677478949
Description: DDB_G0284807 on chromosome: 4 position 2501891 to 2505360
SGD YOL013C 0.000009999254677478949
Description: HRD1 Ubiquitin-protein ligase required for endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins; genetically linked to the unfolded protein response (UPR); regulated through association with Hrd3p; contains an H2 ring finger
Stentor Coeruleus SteCoe_30698 0.000045399929762484854
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00328570(coding)
ATGAGCATCTCAGCAAAAACAAAAAACGCATTCTGTATTTGTTGGTTACTTATAATCACT
TAGACATATAGTTAGCAATAAAATTCTACAAATACTTCAAATTAAACTTAAAAATATTAG
GTTTTTGGGTCAAATTATTTGTATTAAGTCAACCAAAATCTAAGTGCCCAAACTTTTTAG
CTTTCATTATCAAATAGCTATTTCAGTCAGAGATATATTGTGATAGATATAATTATACTG
TCAAAGCAGGATTCATAATTTTAGTTTATATCTTGTTTAAACTACAATCAAGACCCTTTG
TAACAAGATTCGTTTGTTAATTAGGGCCAATATAATTGCAGCTTTACTGATTAGGTCGCT
TAATAGTAGAATTTGGCTTAGCAACTTCTAATTATAGATACGAGCGATCCTTCTTATCAA
TAAAATAACACAATTTACCTAACAGTGCTATACTAATCCACTAATAGCATTTAAAAAGCT
TCTTTAATACCCTTACCTTAACCAATTAATTATGATGTGTATGTTTATTACTACAGTAAA
GTACCATGTCATAGCAGCTGCAACGGTTTAAATGGTTATTGTAATGATTAAACTGGGGTT
TGCAGTTGCAATTAATTCTACACTGGAGCTGATTGTGGCTTGTACTTAAATCCTTTAAAT
ATTCAAAATGATAAAGACAGTACATACATAACAATTTAGCCACGATCCCAATACACTTTT
TCGATAAACATGACAAACATTATTTAGAAAGCTTAAGGATAAAACATTTAATTTTCTCTT
AAAAAGATATATGGGGCATCTAATTTAAATATTTATATGCTTTTTAATCAAAACTAATAA
CCTTCTCCAGATTAATATTAAATGTATTATTCGATGGCTAATAGCTATATGAATATTTCA
AATGTAGACAGTTTGTGCAGTCAATTTTAAAACAGCACAAATAGCTTAAGCAATAATTCT
TAATAACCTTAATCAAATCAATGCTTTATCGTATTTAATATGTAACAATTATCAAACTCA
AAGCTATCTATTATTGTGAATTTTGGTATTAATATTTTAGCTAATACTACTACAAATTCT
GCGACTTCTAACTCAACTTAAAATAATATAAATAATAATACTAACTTAAGAGATCCTAAA
TCTATAACTGGGAACAACTCAGGTAGCAACAGCACATATAGTACTTCACTAACAACAGAT
GTACAATCAAAGTATTAAGCATATGAAATAACAATTTATGTTTTAGTTGGCTTAGCATTT
ATTTTCGTAGCCTTTTTATTACTATTTACTGTATGCAGAAGATGCTAAAAAATGCTTGAA
AGTAGGTATCTAAGTCAACAGTAAGAATAAATTCGAAATGATTAAGAAAATTAATAACAA
CAAGCAAATAATCCAGATTTACTCATAAATTTACAATTGAGATTAAAAATATAATAAAAA
AAAAAGCTCATTCTATCAAAGAAACGTGCACTTTAGAATTATTTAATGCCAAGTATACCT
TTCTAATCATAAACAAGAACATAATTAGATTAAAGCGTACTAGCTGAAAGTGCATTAGAT
AAAGTATCATAAGAAGAAACTTAAAAATAGAAAAGAAAAAATCAAAAAGATAACTTATAA
CTGTAAGATTTGGAGACAAATCTTAATAAGTCAGTTTAGTTGAATACAAGCTTAAATAGC
AGTAAATAATGTTGCTCAATATGTTTAATTGAATTTGTGCCCTAAGAAAAAGTTCAAAAA
ACAATCTGCAGTCATACTTTTCACATCGAATGCATTTAAGATTGGATTTAAAAGAATGAT
AATTGTCCTCTCTGCAGATAGAGTTTTGATATATTAGATATGATAGATTATTTAGCCAAA
GAAAAATTAGCTTAAGCTGAGAATAAAGACTAATAGCTTGCTATCATATAGAATAAGAAT
AAAATTGAAGACATCCTATTAACATAAAAGGAACAAATCATTTAATTTACGGATGATGAT
TTTTTGACTATTTTTAAATTTTTCAAGATAGATAAAGAATTAATCATTCAAAAATAACCA
AAACAACAAAATGCTTAACCAGTAGCTAATACTTAAAGCGATAAAATAACCAAAGATGAA
AAAGCTTTTAAGCTAGAAGAATCTAACGCATTACTTAATTAAAATTATGACTAAGTTACT
TGCTTAAGCCCTACTTATTTGTCAACTCTCTCTTCACCTGTAAGCAAATTTTAAAGCGTA
TATGTTCAATAATAACTTATTTAGTCACCAACAGCAGAATTACCATAACACTCATAGAAT
CCAAGCATTTTTACATTATAAAAATTCTCATAAAACTAATAAGAGTTAAATGCATAAAAT
AATTAGAAAAATACTCACAAATCTATTGATAACATTCCAGAAGAAGTCAGTTATCCAATT
TAAAATTAAAATTACTTTTCTAGTAAGAGCTAAGTATTCACCAAAAAAACTTTGAATCTA
AAAAATAAGAATTCTATTACACATAACCATTTGAAAATGTAAGATGAAAATTAAAACTAA
TATTAAAACTTTGCTAATAACGAAGAGCAAAAAGATGAATAAAATTAAGAATATTCAGAA
AATTAAAACAATTTCTCAAGCTTTTAAAATTAAACTGGAAATTAAAAAATATTTACTTCA
TAAAAAAGTTGA


>TTHERM_00328570(gene)
ATGAGCATCTCAGCAAAAACAAAAAACGCATTCTGTATTTGTTGGTTACTTATAATCACT
TAGACATATAGTTAGCAATAAAATTCTACAAATACTTCAAATTAAACTTAAAAATATTAG
GTTTTTGGGTCAAATTATTTGTATTAAGTCAACCAAAATCTAAGTGCCCAAACTTTTTAG
CTTTCATTATCAAATAGCTATTTCAGTCAGAGATATATTGTGATAGATATAATTATACTG
TCAAAGCAGGATTCATAATTTTAGTTTATATCTTGTTTAAACTACAATCAAGACCCTTTG
TAACAAGATTCGTTTGTTAATTAGGGCCAATATAATTGCAGCTTTACTGATTAGGTCGCT
TAATAGTAGAATTTGGCTTAGCAACTTCTAATTATAGATACGAGCGATCCTTCTTATCAA
TAAAATAACACAATTTACCTAACAGTGCTATACTAATCCACTAATAGCATTTAAAAAGCT
TCTTTAATACCCTTACCTTAACCAATTAATTATGATGTGTATGTTTATTACTACAGTAAA
GTACCATGTCATAGCAGCTGCAACGGTTTAAATGGTTATTGTAATGATTAAACTGGGGTT
TGCAGTTGCAATTAATTCTACACTGGAGCTGATTGTGGCTTGTACTTAAATCCTTTAAAT
ATTCAAAATGATAAAGACAGTACATACATAACAATTTAGCCACGATCCCAATACACTTTT
TCGATAAACATGACAAACATTATTTAGAAAGCTTAAGGATAAAACATTTAATTTTCTCTT
AAAAAGATATATGGGGCATCTAATTTAAATATTTATATGCTTTTTAATCAAAACTAATAA
CCTTCTCCAGATTAATATTAAATGTATTATTCGATGGCTAATAGCTATATGAATATTTCA
AATGTAGACAGTTTGTGCAGTCAATTTTAAAACAGCACAAATAGCTTAAGCAATAATTCT
TAATAACCTTAATCAAATCAATGCTTTATCGTATTTAATATGTAACAATTATCAAACTCA
AAGCTATCTATTATTGTGAATTTTGGTATTAATATTTTAGCTAATACTACTACAAATTCT
GCGACTTCTAACTCAACTTAAAATAATATAAATAATAATACTAACTTAAGAGATCCTAAA
TCTATAACTGGGAACAACTCAGGTAGCAACAGCACATATAGTACTTCACTAACAACAGAT
GTACAATCAAAGTATTAAGCATATGAAATAACAATTTATGTTTTAGTTGGCTTAGCATTT
ATTTTCGTAGCCTTTTTATTACTATTTACTGTATGCAGAAGATGCTAAAAAATGCTTGAA
AGTAGGTATCTAAGTCAACAGTAAGAATAAATTCGAAATGATTAAGAAAATTAATAACAA
CAAGCAAATAATCCAGATTTACTCATAAATTTACAATTGAGATTAAAAATATAATAAAAA
AAAAAGCTCATTCTATCAAAGAAACGTGCACTTTAGAATTATTTAATGCCAAGTATACCT
TTCTAATCATAAACAAGAACATAATTAGATTAAAGCGTACTAGCTGAAAGTGCATTAGAT
AAAGTATCATAAGAAGAAACTTAAAAATAGAAAAGAAAAAATCAAAAAGATAACTTATAA
CTGTAAGATTTGGAGACAAATCTTAATAAGTCAGTTTAGTTGAATACAAGCTTAAATAGC
AGTAAATAATGTTGCTCAATATGTTTAATTGAATTTGTGCCCTAAGAAAAAGTTCAAAAA
ACAATCTGCAGTCATACTTTTCACATCGAATGCATTTAAGATTGGATTTAAAAGAATGAT
AATTGTCCTCTCTGCAGATAGAGTTTTGATATATTAGATATGATAGATTATTTAGCCAAA
GAAAAATTAGCTTAAGCTGAGAATAAAGACTAATAGCTTGCTATCATATAGAATAAGAAT
AAAATTGAAGACATCCTATTAACATAAAAGGAACAAATCATTTAATTTACGGATGATGAT
TTTTTGACTATTTTTAAATTTTTCAAGATAGATAAAGAATTAATCATTCAAAAATAACCA
AAACAACAAAATGCTTAACCAGTAGCTAATACTTAAAGCGATAAAATAACCAAAGATGAA
AAAGCTTTTAAGCTAGAAGAATCTAACGCATTACTTAATTAAAATTATGACTAAGTTACT
TGCTTAAGCCCTACTTATTTGTCAACTCTCTCTTCACCTGTAAGCAAATTTTAAAGCGTA
TATGTTCAATAATAACTTATTTAGTCACCAACAGCAGAATTACCATAACACTCATAGAAT
CCAAGCATTTTTACATTATAAAAATTCTCATAAAACTAATAAGAGTTAAATGCATAAAAT
AATTAGAAAAATACTCACAAATCTATTGATAACATTCCAGAAGAAGTCAGTTATCCAATT
TAAAATTAAAATTACTTTTCTAGTAAGAGCTAAGTATTCACCAAAAAAACTTTGAATCTA
AAAAATAAGAATTCTATTACACATAACCATTTGAAAATGTAAGATGAAAATTAAAACTAA
TATTAAAACTTTGCTAATAACGAAGAGCAAAAAGATGAATAAAATTAAGAATATTCAGAA
AATTAAAACAATTTCTCAAGCTTTTAAAATTAAACTGGAAATTAAAAAATATTTACTTCA
TAAAAAAGTTGA


>TTHERM_00328570(protein)
MSISAKTKNAFCICWLLIITQTYSQQQNSTNTSNQTQKYQVFGSNYLYQVNQNLSAQTFQ
LSLSNSYFSQRYIVIDIIILSKQDSQFQFISCLNYNQDPLQQDSFVNQGQYNCSFTDQVA
QQQNLAQQLLIIDTSDPSYQQNNTIYLTVLYQSTNSIQKASLIPLPQPINYDVYVYYYSK
VPCHSSCNGLNGYCNDQTGVCSCNQFYTGADCGLYLNPLNIQNDKDSTYITIQPRSQYTF
SINMTNIIQKAQGQNIQFSLKKIYGASNLNIYMLFNQNQQPSPDQYQMYYSMANSYMNIS
NVDSLCSQFQNSTNSLSNNSQQPQSNQCFIVFNMQQLSNSKLSIIVNFGINILANTTTNS
ATSNSTQNNINNNTNLRDPKSITGNNSGSNSTYSTSLTTDVQSKYQAYEITIYVLVGLAF
IFVAFLLLFTVCRRCQKMLESRYLSQQQEQIRNDQENQQQQANNPDLLINLQLRLKIQQK
KKLILSKKRALQNYLMPSIPFQSQTRTQLDQSVLAESALDKVSQEETQKQKRKNQKDNLQ
LQDLETNLNKSVQLNTSLNSSKQCCSICLIEFVPQEKVQKTICSHTFHIECIQDWIQKND
NCPLCRQSFDILDMIDYLAKEKLAQAENKDQQLAIIQNKNKIEDILLTQKEQIIQFTDDD
FLTIFKFFKIDKELIIQKQPKQQNAQPVANTQSDKITKDEKAFKLEESNALLNQNYDQVT
CLSPTYLSTLSSPVSKFQSVYVQQQLIQSPTAELPQHSQNPSIFTLQKFSQNQQELNAQN
NQKNTHKSIDNIPEEVSYPIQNQNYFSSKSQVFTKKTLNLKNKNSITHNHLKMQDENQNQ
YQNFANNEEQKDEQNQEYSENQNNFSSFQNQTGNQKIFTSQKS