Identifiers and Description

Gene Model Identifier

TTHERM_00329960

Standard Name

NPC3 (NePhroCystin-3 ortholog)

Aliases

PreTt30301 | 33.m00313 | 3705.m00139

Description

NPC3 tetratricopeptide repeat protein; TPR Domain containing protein; E3 ubiquitin ligase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Domains

  • ( PF00097 ) zinc finger, C3HC4 type (RING
  • ( PF00515 ) tetratricopeptide repeat
  • ( PF00628 ) PHD-finger
  • ( PF01535 ) PPR repeat
  • ( PF06696 ) Streptococcal surface antigen repeat
  • ( PF07719 ) tetratricopeptide repeat
  • ( PF07720 ) Tetratricopeptide repeat
  • ( PF07721 ) Tetratricopeptide repeat
  • ( PF08238 ) Sel1 repeat
  • ( PF08385 ) Dynein heavy chain, N-terminal region
  • ( PF08393 ) Dynein heavy chain, N-terminal region
  • ( PF08908 ) Domain of unknown function (DUF1852)
  • ( PF08946 ) Osmosensory transporter coiled coil
  • ( TIGR00073 ) hydrogenase accessory protein HypB
  • ( TIGR00181 ) oligoendopeptidase F
  • ( TIGR02521 ) type IV pilus biogenesis/stability protein

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08525.1 9.997093137033517e-262
Description: TPR Domain containing protein (1227 aa)
Stentor Coeruleus SteCoe_4411 6.47023492564546e-26
Description: None
DictyBase DDB_G0292714 1.0004572433669413e-23
Description: DDB_G0292714 on chromosome: 6 position 1780390 to 1784905
WormBase WBGene00002215 1.000361553249356e-16
Description: locus:klc-2 Kinesin light chain status:Confirmed UniProt:P46822 protein_id:CCD65112.1
Oxytricha Contig13558.0.g11 0.00000000000003999587784428659
Description: Tetratricopeptide repeat
SGD YOL013C 0.000009999254677478949
Description: HRD1 Ubiquitin-protein ligase required for endoplasmic reticulum-associated degradation (ERAD) of misfolded proteins; genetically linked to the unfolded protein response (UPR); regulated through association with Hrd3p; contains an H2 ring finger

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00329960(coding)
ATGAGCAACGATAAAATTCTACTTCCTATCTTCTCTAGAGCAAAGACATAGTTTTAAGAA
AAATAAATAGATTAAGAATTTAGTATTTGCAATAAACAAATCAATGAAAATCTCTCACCA
CAAATAACTAAAATATATAAAACAAATAACGAAATAAAAAGCCTTCTTGACTAAGGAAAC
TTACAATTATCTTTCAAATTAGCAAAAAAGTAGTATGAATCTAAAAAGAATAATCGAAAT
TCTTCAAATAAGACATTTATTGAATCTCAAATAACTTACGCTGATGTTCTATTTTAATTA
GGTGACTTCAAAGCTTCCTTAGGTCTCTTACTTGACTCTATTGATTGCATATCAAAAAAT
TTAGAAGAACTAGAATAAGAATACAGCAAGGCTTTGGACATGGCAGGAAAAGCCTATCTA
AAGCTAGGCTATTTGAAGAAGGCTGAAGAGTATTTCTTAAAGTCTCTGAATTTTAAGAAA
GAACTTTTCGATTAGGCTAAATCATTTTATTTATTGAGCGTATTATATGAAGAATTAGGC
CAGTATAATTAAGCGATGACAAATTGTGAAAAGAGCTTAAAACTATATATGTCTGTTAAT
TTACATTAGAGTTTAATGTATGCTGAGTGTCTAGACTCAAAAGCTAACTTGTTAAGATCT
CTAGGAAAACTTGAAGAGTCTTTGACATTTTTCAGAGAAGCTTTAGAAATAAAGACAAAG
ATTTTAGGTAAAATAAATCATCCTTAAATAATTTCTTCATAAGAAAATATTGCACTGGTA
CAGAATGAATTAGGAAAATTCTAAGAATCTTATAGCCTTATTTAGGAAGTAGTTAAAAAT
AGAGAGTCATTATATACCTCAGATATATGCCCAAATAGTCACCCTCAGATAGCAGATGCT
TACTAAAATTTAGGCACAATTTAATAGGATTTAGGAATGCTTAAAAAGAGCTTAAATAAT
TAAAAAAAGGCTTTGAGTTTAAGAGAATCTATTTATTAGTATGACCGCTAAATTTAATCC
TAAAATTTCCTTTAGAAAATATTCAATACTGTTAATAGCAATTTGATTAAACTATAATTT
TCTGAAAGTACAACAGAAATTCTTAGTTAAATTTCTACTTAAAATCATCCTGATATTGCT
TCCTCTTACACCTCTTTAGGAATTGTTTATAGGAATATAGGGCATTATGAAGAAGCATAA
GAATATTTACAAAAAGCTTTGAAACAGAGAGAGCTAACTTATGGATATGAGCACACAAAG
GTAAATCAGAAGAGTCCCTTCAACACAACCTAAAATCTTAACAAATTCGCTAAAAAATAT
TTGGTGAAAATGAAAATATCTTATCAGCTCTTTCTATCACCTATTTAGCCTGGTCATATT
ACAATTTATTTGAATATGATTAATCTATTGAACTCAATTAACAAGCGCTAAAAATTTGAA
AACTTAGCTTTGGCGTAGTATAACAGAGAAAATTATGAAGAATCTTTCAAAAATTACCAA
AAAGCCCACGACATAAAAGTAAAAATATACTCAAATGATCATATTTTTATTCCTTCAGCC
AAAAATAACATAGCAGTGGCTTTATATAAGCAGGGAAAGACAGAACAAAGCAAGTTCTTC
TTAAACTAATCTCTATAAATAATATCTAATTTTGAAAATGATGATAAAAATAATAAAGAT
GTAGATCCCTACCTTTTATGCTCAACATTAAACCATTTAGCTTGGGCTCTAACTGAGATG
GAGTAACCTGAAAAAGCTTTATAATACTACAAAAAAACTGAGTAAAAAATGAAATAGCTA
GTAGGAAAAGACCACCTTAATATTTCTAACCTCTATTGTAACATTGGTATTACTTACTTC
CACCTAGGAGATTTTGAAAAGGCTTTGAAATACCATGAATAAGCGTATAGTATAAACATT
TAAGTTTTAGAACCTCATCATTCAATTATTTGCAATAATCTTGACAATATTGGATCATGT
TATAGTAAATAGTAAAAGCACACCAAAGCGCTTGAATATCACATGAAATCCCTATAAATA
AGAAAACAGAAAAGTAAAACTATGAAGGAAGACATTGCTAATTCATATGATCACGTTGCA
AGTACATACTATGACCTTCAAAAATACAAAGAAGCTTTAGAGTATTATTTGCAGGAATTA
AAAATTCGCAAACAATTAAATCAAAAAGGAATTTAGCTGGCTTCTCTTCTTAATAATATA
GCAATAACTTACAAAAATCTAGAAAACCTAGACCGCTCCTTGAAGTACCATTAAAAAACT
TTACGCTTGAGAGAAAGTTATTTGCCTTTTGAACACCAAGAGATTCTTAGTAGTATTTCT
AACATTGCCAGTATCTTATATGACCAAGAAAAATACACTGAAGCTATAGAATTCTACAAA
AAGGAACTTCTATTAAAAGAAAAACTGCATACACCTCAATGTGCTAAAGTTGCTGTAACT
TTGAATAATATTGGATGTTCTTACAAGAATATAAATAACCTTGATGAAGCTGTCAATTAT
CACAGGAAAGCTCTTGAGCTTAGGAAAAAAATTCTAAAAGAAAATGACGATGATATTATC
AGCTCAATAGAGAGCATTTCATCTACTCTTTATGATATGCAAAGATTTTAAGAAGGTCTT
GAATCATATTATGAAGAACTTTAGCTTAAAATAAAGAAATTTGGAGAAGATAATTTGAAA
GTTGCAACAACTTATAATAATATTGCGTGCACTCTTAAAAATTTAGGTCAAATTGCTGAG
GCATTAAAAATGCATCAAAAATCCTTAGTTATAAAGTAAAAAATTTTAGGTCATGATCAC
TTAGATGTAGCAACCTCATTAGATAATATTGCATCAATTATTTATGACCAGAATGACTTT
TAATACGCACTAGAGATGTATAAAAAAGTTTTAGGTATAAGGAGAAAATGCTACTAAACA
AATAATCTATAAATAGCTGTAACACTCCATAATTTAGCTTGCACCTACCATAATTTGAAA
GATTACGAGTCTGCTTTACAGCTACAAATAGAGGTCCTAGAAATGAGAAAATAAATTTAA
GGCCCAGAATCAAAAGACATAATAACTTCTTTAGACAATATTGCATCGAATTTATATGAT
AGTGGCAAATATGAGCAAGCTATTGTTTATTACCAAGATGAACTAGCTTTGATGAGAAAA
GTTGAACCTGAAAACCAAGCTAGAGCAGCTACAACACTAAATAATATTGCATGTACTTTG
CATAACCTGAAGAGATTAAGTGAATCTTTTGAATATCATAATTAAGCATTAAAGATCCGT
AGAGAAAATTTAGGAGAAACTCATCCTGAAACAGTTTCGTCTTTAAATAATATAGCTTCT
AATTTATTTAATGTAGGCAAGCTAGATGAAGCTCTTAATACATTTCTACGTGTGCTTTAA
ATTCGTATTCAATAATAAGAGTGTAAAATAAAAATAGCAACAGCCTATGATAATGTTGGT
TCCACTTATTTCTCTCTCCTCGAATTTGAGAAAGCTCTTGAGCATTTTGAGTAATCTTAT
GAAATAAGAAGAACTTATAATTTGGATGATTTATAGAACTCTCAAGATATGATAAATGCA
GCACGCTAAATGATACAAAAAATAGAACCAATCAGGAATCTTCCAATAACAAAATATACA
GGAAAAAACTCATAAGAAAATAATGATAAAAATAATCAAGAAAGTATTGTAAAAGGAGAA
GACGAAGAGGAAATATGCAATATATGTCTTGAAAATCTTAACAATAACTAAGAATTGCGT
GTACTTCCTTGTAGCCACTTTTATCATACGTTCTGCATAGACAAATGGTTACTTGCTAAA
TAATCTTGTCCTAATTGCAGGTAGTGTCCTATTGTAAATTATTAACAAGATAACTAAGAT
AAAATCGAATGA


>TTHERM_00329960(gene)
ATGAGCAACGATAAAATTCTACTTCCTATCTTCTCTAGAGCAAAGACATAGTTTTAAGAA
AAATAAATAGATTAAGAATTTAGTATTTGCAATAAACAAATCAATGAAAATCTCTCACCA
CAAATAACTAAAATATATAAAACAAATAACGAAATAAAAAGCCTTCTTGACTAAGGAAAC
TTACAATTATCTTTCAAATTAGCAAAAAAGTAGTATGAATCTAAAAAGAATAATCGAAAT
TCTTCAAATAAGACATTTATTGAATCTCAAATAACTTACGCTGATGTTCTATTTTAATTA
GGTGACTTCAAAGCTTCCTTAGGTCTCTTACTTGACTCTATTGATTGCATATCAAAAAAT
TTAGAAGAACTAGAATAAGAATACAGCAAGGCTTTGGACATGGCAGGTATTTATTTATTG
ATTTATTTGTTTTTTTACTTAGAGTTTTACCAAAAAAAGAATTGAAACATATTTAAAAAA
GCTGTTTTTCCAAAATGTTCTACTTGAAAAAAAAAAAATAATAATTCTAAAATATATTAA
TAGTTTTATTTATTTATTAATAGGAAAAGCCTATCTAAAGCTAGGCTATTTGAAGAAGGC
TGAAGAGTATTTCTTAAAGTCTCTGAATTTTAAGAAAGAACTTTTCGATTAGGCTAAATC
ATTTTATTTATTGAGCGTATTATATGAAGAATTAGGCCAGTATAATTAAGCGATGACAAA
TTGTGAAAAGAGCTTAAAACTATATATGTCTGTTAATTTACATTAGAGTTTAATGTATGC
TGAGTGTCTAGACTCAAAAGCTAACTTGTTAAGATCTCTAGGAAAACTTGAAGAGTCTTT
GACATTTTTCAGAGAAGCTTTAGAAATAAAGACAAAGATTTTAGGTAAAATAAATCATCC
TTAAATAATTTCTTCATAAGAAAATATTGCACTGGTACAGAATGAATTAGGAAAATTCTA
AGAATCTTATAGCCTTATTTAGGAAGTAGTTAAAAATAGAGAGTCATTATATACCTCAGA
TATATGCCCAAATAGTCACCCTCAGATAGCAGATGCTTACTAAAATTTAGGTATATTTAT
TTAATTTTCATTAAAATTCGCATTTCTATTTTATGATTAAAAAATATAAATTAAAATTAG
TTTTAACTTTATTTTCTATATAACAAATATTTAAGCATTCATTCTATTTGTTTATTGTAC
AATTTTTAAAAGCAAAAAAGATTTCATTAAATATATTTTATTAAGAATCAAATAACTCTA
TAAATTGTAGTTTCTATCTAAAAATAATCTAATTAATTTATCATCTCATAAAAAAAAACT
TTATTAAAAGTACTTATTTATTATAAAGGAAAGGCATTTAAACAAATAAGTATAATGCAA
TTCCTTTTTTTATCATATAAAAACAATATTAATTTCTTTAAAGAGATTTACTTTCACTAG
AAAATTTTAATTTCACAAAAAACATTTGATTTACAAAATATTTATTTGAATACTTGACAC
AAAAAATTATATATATCAATAGGCACAATTTAATAGGATTTAGGAATGCTTAAAAAGAGC
TTAAATAATTAAAAAAAGGCTTTGAGTTTAAGAGAATCTATTTATTAGTATGACCGCTAA
ATTTAATCCTAAAATTTCCTTTAGAAAATATTCAATACTGTTAATAGCAATTTGATTAAA
CTATAATTTTCTGAAAGTACAACAGAAATTCTTAGTTAAATTTCTACTTAAAATCATCCT
GATATTGCTTCCTCTTACACCTCTTTAGGAATTGTTTATAGGAATATAGGGCATTATGAA
GAAGCATAAGAATATTTACAAAAAGCTTTGAAACAGAGAGAGCTAACTTATGGATATGAG
CACACAAAGTACGCAATTACACTAAATTACCTCGCCTGAACCCTTGACGAATAGGGTAAA
TCAGAAGAGTCCCTTCAACACAACCTAAAATCTTAACAAATTCGCTAAAAAATATTTGGT
GAAAATGAAAATATCTTATCAGCTCTTTCTATCACCTATTTAGCCTGGTCATATTACAAT
TTATTTGAATATGATTAATCTATTGAACTCAATTAACAAGCGCTAAAAATTTGGTAAAGA
AATATTAAGAGTCACCCTTATATTACTTCTACTTTAGAAAACTTAGCTTTGGCGTAGTAT
AACAGAGAAAATTATGAAGAATCTTTCAAAAATTACCAAAAAGCCCACGACATAAAAGTA
AAAATATACTCAAATGATCATATTTTTATTCCTTCAGCCAAAAATAACATAGCAGTGGCT
TTATATAAGCAGGGAAAGACAGAACAAAGCAAGTTCTTCTTAAACTAATCTCTATAAATA
ATATCTAATTTTGAAAATGATGATAAAAGTAAATATTTATTAAAATTTGATTATAATTAT
TTTTTTAATTTTTGTTATATTTTCTAAATAATTAATTATGCTAAAAAACGCTTTATAATT
TCTAAAAATTTTCAAACAAAATATATCAAAAAATAAAAATAAATTTACAAAAAAAAAAAA
TGAATTTTGAAATATTTTTGTAATACTTAATAATATAAATTGAATAACCTTAATTACTTA
TAGATGGTATTAGTTTAATAAAAAAATATTTTAAAACATTAACTCAATAAAAAACTAGCA
AATTTTTTATTTGTTTTATCATTCTTTTAATTTTAATTATAAATTATTGTAAACATTTTA
TTAATAATTTTTTTATATAAGATAATAAAGATGTAGATCCCTACCTTTTATGCTCAACAT
TAAACCATTTAGCTTGGGCTCTAACTGAGATGGAGTAACCTGAAAAAGCTTTATAATACT
ACAAAAAAACTGAGTAAAAAATGAAATAGCTAGTAGGAAAAGACCACCTTAATATTTCTA
ACCTCTATTGTAACATTGGTATTACTTACTTCCACCTAGGAGATTTTGAAAAGGCTTTGA
AATACCATGAATAAGCGTATAGTATAAACATTTAAGTTTTAGAACCTCATCATTCAATTA
TTTGCAATAATCTTGACAATATTGGATCATGTTATAGTAAATAGTAAAAGCACACCAAAG
CGCTTGAATATCACATGAAATCCCTATAAATAAGAAAACAGAAAAGTAGTACTGAATTTA
AGATTTTATTTTAACTTAATGAATTTAAATATTAACATCAGTAATTTAAAAAAAATTTAA
ATATATAGGTAAAACTATGAAGGAAGACATTGCTAATTCATATGATCACGTTGCAAGTAC
ATACTATGACCTTCAAAAATACAAAGAAGCTTTAGAGTATTATTTGCAGGAATTAAAAAT
TCGCAAACAATTAAATCAAAAAGGAATTTAGCTGGCTTCTCTTCTTAATAATATAGCAAT
AACTTACAAAAATCTAGAAAACCTAGACCGCTCCTTGAAGTACCATTAAAAAACTTTACG
CTTGAGAGAAAGTTATTTGCCTTTTGAACACCAAGAGATTCTTAGTAGTATTTCTAACAT
TGCCAGTATCTTATATGACCAAGAAAAATACACTGAAGCTATAGAATTCTACAAAAAGGA
ACTTCTATTAAAAGAAAAACTGCATACACCTCAATGTGCTAAAGTATATTTACTTTTAAT
TATAATTTATTAAATATATATGTGGTTGTGAATATTTATACTATTTGTAAAGATTTTTTT
AAATAAAATTTTGATTGAAATTTTAAACGATTATAAATAGGTTGCTGTAACTTTGAATAA
TATTGGATGTTCTTACAAGAATATAAATAACCTTGATGAAGCTGTCAATTATCACAGGAA
AGCTCTTGAGCTTAGGAAAAAAATTCTAAAAGAAAATGACGATGATATTATCAGCTCAAT
AGAGAGCATTTCATCTACTCTTTATGATATGCAAAGATTTTAAGAAGGTCTTGAATCATA
TTATGAAGAACTTTAGCTTAAAATAAAGAGTAATTTTTGATCTATATAATTTCCATCAAT
TTAAAATTTTTTTGAAATATAGAATTTGGAGAAGATAATTTGAAAGTTGCAACAACTTAT
AATAATATTGCGTGCACTCTTAAAAATTTAGGTCAAATTGCTGAGGCATTAAAAATGCAT
CAAAAATCCTTAGTTATAAAGTAAAAAATTTTAGGTCATGATCACTTAGATGTAGCAACC
TCATTAGATAATATTGCATCAATTATTTATGACCAGAATGACTTTTAATACGCACTAGAG
ATGTATAAAAAAGTTTTAGGTATAAGGAGAAAATGCTACTAAACAAATAATCTATAAATA
GCTGTAACACTCCATAATTTAGCTTGCACCTACCATAATTTGAAAGATTACGAGTCTGCT
TTACAGCTACAAATAGAGGTAAACAAAAAATTATTTTAATCTAATGATTTTTCATTTAAA
AATCCTTGAATCATTTTTTTTCAACTTTTTTTTTAAATTAGGTCCTAGAAATGAGAAAAT
AAATTTAAGGCCCAGAATCAAAAGACATAATAACTTCTTTAGACAATATTGCATCGAATT
TATATGATAGTGGCAAATATGAGCAAGCTATTGTTTATTACCAAGATGAACTAGCTTTGA
TGAGAAAAGTTGAACCTGAAAACCAAGCTAGAGCAGCTACAACACTAAATAATATTGCAT
GTACTTTGCATAACCTGAAGAGATTAAGTGAATCTTTTGAATATCATAATTAAGCATTAA
AGATCCGTAGAGAAAATTTAGGAGAAACTCATCCTGAAACAGTTTCGTCTTTAAATAATA
TAGCTTCTAATTTATTTAATGTAGGCAAGCTAGATGAAGCTCTTAATACATTTCTACGTG
TGCTTTAAATTCGTATTCAATAATAAGAGTGTAAAATAAAAATAGCAACAGCCTATGATA
ATGTTGGTTCCACTTATTTCTCTCTCCTCGAATTTGAGAAAGCTCTTGAGCATTTTGAGT
AATCTTATGAAATAAGAAGAACTTATAATTTGGATGATTTATAGAACTCTCAAGATATGA
TAAATGCAGCACGCTAAATGATACAAAAAATAGAACCAATCAGGAATCTTCCAATAACAA
AATATACAGGAAAAAACTCATAAGAAAATAATGATAAAAATAATCAAGAAAGTATTGTAA
AAGGAGAAGACGAAGAGGAAATATGCAATATATGTCTTGAAAATCTTAACAATAACTAAG
AATTGCGTGTACTTCCTTGTAGCCACTTTTATCATACGTTCTGCATAGACAAATGGTTAC
TTGCTAAATAATCTTGTCCTAATTGCAGGTAGTGTCCTATTGTAAATTATTAACAAGATA
ACTAAGATAAAATCGAATGA


>TTHERM_00329960(protein)
MSNDKILLPIFSRAKTQFQEKQIDQEFSICNKQINENLSPQITKIYKTNNEIKSLLDQGN
LQLSFKLAKKQYESKKNNRNSSNKTFIESQITYADVLFQLGDFKASLGLLLDSIDCISKN
LEELEQEYSKALDMAGKAYLKLGYLKKAEEYFLKSLNFKKELFDQAKSFYLLSVLYEELG
QYNQAMTNCEKSLKLYMSVNLHQSLMYAECLDSKANLLRSLGKLEESLTFFREALEIKTK
ILGKINHPQIISSQENIALVQNELGKFQESYSLIQEVVKNRESLYTSDICPNSHPQIADA
YQNLGTIQQDLGMLKKSLNNQKKALSLRESIYQYDRQIQSQNFLQKIFNTVNSNLIKLQF
SESTTEILSQISTQNHPDIASSYTSLGIVYRNIGHYEEAQEYLQKALKQRELTYGYEHTK
VNQKSPFNTTQNLNKFAKKYLVKMKISYQLFLSPIQPGHITIYLNMINLLNSINKRQKFE
NLALAQYNRENYEESFKNYQKAHDIKVKIYSNDHIFIPSAKNNIAVALYKQGKTEQSKFF
LNQSLQIISNFENDDKNNKDVDPYLLCSTLNHLAWALTEMEQPEKALQYYKKTEQKMKQL
VGKDHLNISNLYCNIGITYFHLGDFEKALKYHEQAYSINIQVLEPHHSIICNNLDNIGSC
YSKQQKHTKALEYHMKSLQIRKQKSKTMKEDIANSYDHVASTYYDLQKYKEALEYYLQEL
KIRKQLNQKGIQLASLLNNIAITYKNLENLDRSLKYHQKTLRLRESYLPFEHQEILSSIS
NIASILYDQEKYTEAIEFYKKELLLKEKLHTPQCAKVAVTLNNIGCSYKNINNLDEAVNY
HRKALELRKKILKENDDDIISSIESISSTLYDMQRFQEGLESYYEELQLKIKKFGEDNLK
VATTYNNIACTLKNLGQIAEALKMHQKSLVIKQKILGHDHLDVATSLDNIASIIYDQNDF
QYALEMYKKVLGIRRKCYQTNNLQIAVTLHNLACTYHNLKDYESALQLQIEVLEMRKQIQ
GPESKDIITSLDNIASNLYDSGKYEQAIVYYQDELALMRKVEPENQARAATTLNNIACTL
HNLKRLSESFEYHNQALKIRRENLGETHPETVSSLNNIASNLFNVGKLDEALNTFLRVLQ
IRIQQQECKIKIATAYDNVGSTYFSLLEFEKALEHFEQSYEIRRTYNLDDLQNSQDMINA
ARQMIQKIEPIRNLPITKYTGKNSQENNDKNNQESIVKGEDEEEICNICLENLNNNQELR
VLPCSHFYHTFCIDKWLLAKQSCPNCRQCPIVNYQQDNQDKIE