Identifiers and Description

Gene Model Identifier

TTHERM_00333210

Standard Name

RPL4 (Ribosomal Protein of the large subunit)

Aliases

PreTt05965 | 34.m00202 | 3689.m00001

Description

RPL4 60S ribosomal protein L4; ribosomal protein L4/L1 family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00573 ) ribosomal protein L4/L1 family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_16012.1 9.997093137033517e-262
Description: ribosomal protein L4/L1 family protein (411 aa)
Oxytricha Contig3676.0.g1 6.999872280442742e-128
Description: Ribosomal protein L4/L1 family
DictyBase DDB_G0277803 3.999369102302453e-125
Description: rpl4 on chromosome: 2 position 8431684 to 8432899
WormBase WBGene00004415 4.998015698166016e-118
Description: locus:rpl-4 60S ribosomal protein L4 status:Confirmed UniProt:O02056 protein_id:CCD61249.1
SGD YDR012W 9.999453238338778e-112
Description: RPL4B Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl4Ap and has similarity to E. coli L4 and rat L4 ribosomal proteins
Stentor Coeruleus SteCoe_25345 2.0842828425817514e-52
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:22052974: Klinge S, Voigts-Hoffmann F, Leibundgut M, Arpagaus S, Ban N (2011) Crystal structure of the eukaryotic 60S ribosomal subunit in complex with initiation factor 6. Science (New York, N.Y.) 334(6058):941-8

Sequences

>TTHERM_00333210(coding)
ATGACTTCTAGACCTCAAATCCACGTCCACGACGCTAAGGAAGCTAACAAGCAAACCGCT
ACCAAGCTCACCCTCCCCGCTGTCTTCACTGCTCCCATCAGAACTGATATTGTCCACAAG
GTTTTCACCGACCTTAACAAGAACAGAAAGCAAGCTTCCGGAGTCAAGATTTCCACCAGA
GGTACTGCTGGTATGGGTCACTCCGCTGAATCTTGGGGTACTGGTAGAGCTGTTGCTCGT
ATTCCCAGAGTTGGTGGTTCTGGTACTCACAGATCCGGTCAAGCCGCCTTCGGTAACCAA
TGTAGAAAGGGTAGAATGTTCGCTCCCTTGAAGACCTACAGAAGAGTCCACAGAAGAGTC
AATGTCAACCAAAAGAGACACGCCGTCGCTGCTGCCCTCGCTGCCTCTGCTTTGGTTCCT
TTAGTTTTCGCTAGAGGTCACAGAATCTCCAACGTTTAGGAACTCCCCTACGTTTTCGAT
GACTCCGTCGAATCTTATGAAAAGACCAAGCAAGCTGTTGCTTTCCTCAAGAGAGTCGGT
GCTTACGATGATGTCCTCAGAGTTGCTGAAACCAAGGCACTCAGAGCTGGTCAAGGTAAA
TTGAGAAACAGAAGATACAAACTCAGAAGAGGTCCCCTCGTCGTCTACGGTAACGAAAAG
TCCACCCTCACCAGAGCTCTTAGAAACATTCCTGGTGTTGATGTTTGCAACGTTAACAGA
CTTAACTTATTATAATTGGCTCCTGGTGGTCACGTTGGTAGATTCATCATCTGGACTGAA
TCTGCTTTCAAGAAGTTAAACGAAATCTTCGGTACTTACTCTACTACTGGTGTCCAAAAG
AGCGGTTACCAATTATAAAGACCCCTCTTGGCCAACGCTGACATCGCTAGAATCATCAAC
TCTAACGAAGTCTAATCCGTTGTTAAGGTTGCTGGTACCACCGAAACCCACGAAAGAAAG
AAAAACCCCTTGACCAACAACAACGCTCTCTTCAAGTTAAACCCCGCTGCTAAGATCGTT
AAGGAACAAGCTAAGAAGGCTGCTGAAGCTTCCAAGGCTAAGAGATAAGCTACCCTCAAG
GCCAACAGAAAGGCTGCCAAGACCCACAAGAAGGGATCTCAAGCTTGGATTGCTGCTTTC
AACAAGGCTAACGAAGAAGCTATTGCTAAGGCTAGATAAGAAGATGCTGATTTCATTGCT
CAAGGTCAAGAAATCAAGGAAGGTGACGAATGA


>TTHERM_00333210(gene)
ATGACTTCTAGACCTCAAATCCACGTCCACGACGCTAAGGAAGCTAACAAGCAAACCGCT
ACCAAGCTCACCCTCCCCGCTGTCTTCACTGCTCCCATCAGAACTGATATTGTCCACAAG
GTTTTCACCGACCTTAACAAGAACAGAAAGCAAGCTTCCGGAGTCAAGATTTCCACCAGA
GGTACTGCTGGTAAGACATTCATAAAATTATTTATTATTCATCCTTTAAAAGGAATCAAA
TATTTATAAATATCTTGGCATGTTCGATGTTAATATTAAGAGTATAAGTGAATTTGTTTA
TTGCTTTGAGAAATTATTTTTAGCATCATAATATTACAAAAATCAAGTCGGTTGAAAAGA
TAAATTAAGTAGCGCATCTGTATAATAGAGAAGTTTTCATAAAATATCAGCAAGACAAAA
ATAAATTATGATTGATAGTAACTACTAATTCTAAAGGGTTGCAAGTAGAAAAGATAGCTA
TACTTAATCAATTTTAGTTAATGTGTGATAAGCAGGGCATTTGGTTTAGATTTCAAAATA
AAGTGGGCTGATAGTTTGTTTATATAACAAATAAATTTGGTAAAGAAAGAGAATCTCATA
AAAAATAAATTTAGGTTATTATCATATATTTGTCCTATTCCCTTTAAGCAAAGTATTAAT
AGTAAATTGCAAAATGCTATGTAAATATCTAAGGGTGAAAACTAAATAAATAAATAAATA
TCTATTTGAAAGATGCTTTAAAGTATTGTAGCATGAAATTAATTGCCCAGAAATGTATTC
AAATTAAGGTTTTGTTAAACGATTTGAATCGCTTCTACTGAATTATCATATTAAAGAGAA
TATATAGTGCTTGAAAAATAAAAATAAACTCATAAGCAATATCAAATTTAAATATATTCA
CTTAAAATTTAACCAGACGTGCTAAGCATAATTATAAATCAAAATATTATTATTTACATT
TTGAATTTATTTTAAAGATTCATTTATTTTTAATTAGGTATGGGTCACTCCGCTGAATCT
TGGGGTACTGGTAGAGCTGTTGCTCGTATTCCCAGAGTTGGTGGTTCTGGTACTCACAGA
TCCGGTCAAGCCGCCTTCGGTAACCAATGTAGAAAGGGTAGAATGTTCGCTCCCTTGAAG
ACCTACAGAAGAGTCCACAGAAGAGTCAATGTCAACCAAAAGAGACACGCCGTCGCTGCT
GCCCTCGCTGCCTCTGCTTTGGTTCCTTTAGTTTTCGCTAGAGGTCACAGAATCTCCAAC
GTTTAGGAACTCCCCTACGTTTTCGATGACTCCGTCGAATCTTATGAAAAGACCAAGCAA
GCTGTTGCTTTCCTCAAGAGAGTCGGTGCTTACGATGATGTCCTCAGAGTTGCTGAAACC
AAGGCACTCAGAGCTGGTCAAGGTAAATTGAGAAACAGAAGATACAAACTCAGAAGAGGT
CCCCTCGTCGTCTACGGTAACGAAAAGTCCACCCTCACCAGAGCTCTTAGAAACATTCCT
GGTAATTCTTTGAACATTTAAAAAGAAAATAAAATTCACATTGCCACTAGTGCAATAAAT
AAATAATTTATTTAGTCTAAATTTGGTTTTAAAATTCAACAAGTTCTATAAATAGTTAAA
TCAAATTTAATTTAATTGAGCTATTGAAAGAATATTTATTTAAATATTAGCAAATAAATT
AAATTTAGACTAAATTTGATAAATTTGTCCTCATTTTTTGAATGAAAAATTAAAATTTTA
ATTAAAATATTGAATAGGTGTTGATGTTTGCAACGTTAACAGACTTAACTTATTATAATT
GGCTCCTGGTGGTCACGTTGGTAGATTCATCATCTGGACTGAATCTGCTTTCAAGAAGTT
AAACGAAATCTTCGGTACTTACTCTACTACTGGTGTCCAAAAGAGCGGTTACCAATTATA
AAGACCCCTCTTGGCCAACGCTGACATCGCTAGAATCATCAACTCTAACGAAGTCTAATC
CGTTGTTAAGGTTGCTGGTACCACCGAAACCCACGAAAGAAAGAAAAACCCCTTGACCAA
CAACAACGCTCTCTTCAAGTTAAACCCCGCTGCTAAGATCGTTAAGGAACAAGCTAAGAA
GGCTGCTGAAGCTTCCAAGGCTAAGAGATAAGCTACCCTCAAGGCCAACAGAAAGGCTGC
CAAGACCCACAAGAAGGGATCTCAAGCTTGGATTGCTGCTTTCAACAAGGCTAACGAAGA
AGCTATTGCTAAGGCTAGATAAGAAGATGCTGATTTCATTGCTCAAGGTCAAGAAATCAA
GGAAGGTGACGAATGA


>TTHERM_00333210(protein)
MTSRPQIHVHDAKEANKQTATKLTLPAVFTAPIRTDIVHKVFTDLNKNRKQASGVKISTR
GTAGMGHSAESWGTGRAVARIPRVGGSGTHRSGQAAFGNQCRKGRMFAPLKTYRRVHRRV
NVNQKRHAVAAALAASALVPLVFARGHRISNVQELPYVFDDSVESYEKTKQAVAFLKRVG
AYDDVLRVAETKALRAGQGKLRNRRYKLRRGPLVVYGNEKSTLTRALRNIPGVDVCNVNR
LNLLQLAPGGHVGRFIIWTESAFKKLNEIFGTYSTTGVQKSGYQLQRPLLANADIARIIN
SNEVQSVVKVAGTTETHERKKNPLTNNNALFKLNPAAKIVKEQAKKAAEASKAKRQATLK
ANRKAAKTHKKGSQAWIAAFNKANEEAIAKARQEDADFIAQGQEIKEGDE