Identifiers and Description

Gene Model Identifier

TTHERM_00338360

Standard Name

RAB66 (RAB GTPase 66)

Aliases

PreTt06077 | 34.m00314 | 3689.m00110

Description

RAB66 small guanosine triphosphatase family Ras family protein; Novel Rab family protein; small monomeric GTPase that regulates membrane fusion and fission events

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • ferric-hydroxamate transmembrane transporter activity (IEA) | GO:0015622
  • glyceraldehyde-3-phosphate dehydrogenase (NADP+) (non-phosphorylating) activity (IEA) | GO:0008886
  • rhamnulokinase activity (IEA) | GO:0008993

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15112.1 3.00004133315474e-119
Description: Ras family protein (571 aa)
Oxytricha Contig9955.0.g63 9.999888128184441e-42
Description: Ras family
WormBase WBGene00006833 1.000403801267624e-40
Description: locus:unc-108 status:Confirmed UniProt:O01577 protein_id:CCD66422.1
DictyBase DDB_G0277101 9.9981864321491e-40
Description: rab11C on chromosome: 2 position 7509311 to 7510238
SGD YER031C 2.0006622580855403e-35
Description: YPT31 Rab family GTPase, very similar to Ypt32p; involved in the exocytic pathway; mediates intra-Golgi traffic or the budding of post-Golgi vesicles from the trans-Golgi
Stentor Coeruleus SteCoe_12353 7.781132241133797e-20
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00338360(coding)
ATGATAAATTATTTGGTTAAATTATAAATTAATTAATTGATTAATTGTTTATCAAGCAAA
TTAGTTAGTAATTTTGCAAAATTAAAAAAAAATTAAAAATTCAAAATACCCTTTAAATAC
ATATCTTTATTGATTGATTATAAGCAAACATACAAACAAAGAAAGTAAGGACTCAACATA
GATAAAATGCTCACACAGTCAGAAATGAATAATTAAAATATTGGTTTTTTGATTAAAACA
ATCATCGTCGGTGATGCATCTGTAGGAAAATCAAGCATATTAAAGCGCTTTACATAAAAC
GAGTTTTAAGATACTTATAATGCCACTATCGGTCTTGAATTCGAAAGCAAAGATGTTACT
ATTGAAAGCGATAATTAAGAGGAAAGCTCTAAAATAACACTTTAAATATGGGATACTGCA
GGATAGGAGTCTTTCAGATCTATTGTTAAATCTTTTTATAGAAACTCTGCAGCTGTCTTA
CTTGTTTATGATACTAAAGTGAGAAAATCTTTTGAAGGTTTGAAAATTTGGATAAATGAA
ATTAAAGAAAACTCTCACAATGATGTTATCATAGTTTTGATTGGAAATAAAAAAGATGAA
GAATAGGACGAAGTTAAGGTAAAAGAAAGGGAAATATAAGATTTAATTTAAGAGTATAAC
TTAGCCTATCACTTCTTTACTTCAGCAAAGAATGATTATAATATTAAAAAATCTTTCGAG
TATGTTGCTACTGAGGTATATAATAGATTTATAAAGGATAAGCATGAATTAAAAAACGGC
ATTAGATCAAGCACAAGAAGCTTGTCTATTGATAATAACAAAGCAAGAGAGCTCTAATAA
TAAATCGATTAATAAGAATCTAGTCAACCAACACCTACTCATAAATACTCTATAAAAAAT
AAAATAAACGATAACTCAATTAATAATCAATCATCTAATAAAGAACATCTCATCCCTAAA
ACAGAGACTGAAAAACCCAAAAAAAAAGGATGTTGTTGA


>TTHERM_00338360(gene)
ATGATAAATTATTTGGTTAAATTATAAATTAATTAATTGATTAATTGTTTATCAAGCAAA
TTAGTTAGTAATTTTGCAAAATTAAAAAAAAATTAAAAATTCAAAATACCCTTTAAATAC
ATATCTTTATTGATTGATTATAAGCAAACATACAAACAAAGAAAGTAAGGACTCAACATA
GATAAAATGCTCACACAGTCAGAAATGAATAATTAAAATATTGGTTTTTTGATTAAAACA
ATCATCGTCGGTGATGCATGTAAGTGCTTTTTTATCAAGTTTGTTAAAGATTTTAAGAAG
TAAATTAATTTTTTTTATCCATATAACAAAAAAGCTGTAGGAAAATCAAGCATATTAAAG
CGCTTTACATAAAACGAGTTTTAAGATACTTATAATGCCACTATCGGTCTTGAATTCGAA
AGCAAAGATGTTACTATTGAAAGCGATAATTAAGAGGAAAGCTCTAAAATAACACTTTAA
ATATGGGATACTGTAAGTGATATAAATAGCTTTTTAAATTAATTTATAAAGTAATACTTT
ATTCAAAACTTAAATTTATTAAAATAGGCAGGATAGGAGTCTTTCAGATCTATTGTTAAA
TCTTTTTATAGAAACTCTGCAGCTGTCTTACTTGTTTATGATACTAAAGTGTAAGAAATT
ATTCATTTAATTGAATAATAAATTATTTCTTTTATTTTACAGGAGAAAATCTTTTGAAGG
TTTGAAAATTTGGATAAATGAAATTAAAGAAAACTCTCACAATGATGTTATCATAGTTTT
GATTGGAAATAAAAAAGATGAAGAATAGGAGTAAATTTATTTATAATTGGAAATAAATAG
TTAAATTAATTAACAACATTCTCAATAAAATTTTAGCGAAGTTAAGGTAAAAGAAAGGGA
AATATAAGATTTAATTTAAGAGTATAACTTAGCCTATCACTTCTTTACTTCAGCAAAGAA
TGATTATAATATTAAAAAAGTAAGTGCATTACAATTTTATAATTATAAATGTAAGTGAAA
ATTTTTATTTTATTAAATTTAGTCTTTCGAGTATGTTGCTACTGAGGTATATAATAGATT
TATAAAGGATAAGCATGAATTAAAAAACGGCATTAGATCAAGCACAAGAAGCTTGTCTAT
TGATAATAACAAAGCAAGAGAGCTCTAATAATAAATCGATTAATAAGAATCTAGTCAACC
AACACCTACTCATAAATACTCTATAAAAAATAAAATAAACGATAACTCAATTAATAATCA
ATCATCTAATAAAGAACATCTCATCCCTAAAACAGAGACTGAAAAACCCAAAAAAAAAGG
ATGTTGTTGA


>TTHERM_00338360(protein)
MINYLVKLQINQLINCLSSKLVSNFAKLKKNQKFKIPFKYISLLIDYKQTYKQRKQGLNI
DKMLTQSEMNNQNIGFLIKTIIVGDASVGKSSILKRFTQNEFQDTYNATIGLEFESKDVT
IESDNQEESSKITLQIWDTAGQESFRSIVKSFYRNSAAVLLVYDTKVRKSFEGLKIWINE
IKENSHNDVIIVLIGNKKDEEQDEVKVKEREIQDLIQEYNLAYHFFTSAKNDYNIKKSFE
YVATEVYNRFIKDKHELKNGIRSSTRSLSIDNNKARELQQQIDQQESSQPTPTHKYSIKN
KINDNSINNQSSNKEHLIPKTETEKPKKKGCC