Identifiers and Description

Gene Model Identifier

TTHERM_00338470

Standard Name

PFK3 (PhosphoFructoKinase)

Aliases

PreTt06087 | 34.m00324 | 3689.m00120

Description

PFK3 6-phosphofructokinase; Alpha subunit of heterooctameric phosphofructokinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

  • 1,2-diacyl-sn-glycero-3-phosphocholine metabolic process (IEA) | GO:0006653

Domains

  • ( PF00365 ) Phosphofructokinase
  • ( PF02078 ) Synapsin, N-terminal domain
  • ( TIGR00689 ) sugar-phosphate isomerases, RpiB/LacA/LacB family
  • ( TIGR01274 ) 1-aminocyclopropane-1-carboxylate deaminase
  • ( TIGR02477 ) diphosphate--fructose-6-phosphate 1-phosphotransferase
  • ( TIGR02478 ) 6-phosphofructokinase
  • ( TIGR02482 ) 6-phosphofructokinase
  • ( TIGR02483 ) phosphofructokinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15103.1 9.997093137033517e-262
Description: phosphofructokinase (561 aa)
Oxytricha Contig14330.0.g57 2.000724368835138e-100
Description: Phosphofructokinase
Stentor Coeruleus SteCoe_6667 7.47197233734299e-43
Description: None
DictyBase DDB_G0274111 0.0000000000005000841553255702
Description: pfkA on chromosome: 2 position 4510635 to 4513139
SGD YGR240C 0.0000000020002373268528243
Description: PFK1 Alpha subunit of heterooctameric phosphofructokinase involved in glycolysis, indispensable for anaerobic growth, activated by fructose-2,6-bisphosphate and AMP, mutation inhibits glucose induction of cell cycle-related genes
WormBase WBGene00008230 0.000000030002053728821195
Description: locus:pfk-2 Probable 6-phosphofructokinase status:Partially_confirmed UniProt:Q27483 protein_id:CAA94737.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00338470(coding)
ATGAGTAATAGATAAGAGTAAAAAATTAGTTCAATCATTCAATTAATAACAATACTTATT
AGTATAAGAAGACGAATAATTAATTAATAAATTAATTAACATGAATTATTTCTAAATAAA
AGTGTGATCGGACTTCTATTATTAACTAAATCTTTAATTAGATACATACATACTGCTTTT
AATAAAATAAACTTAGAAAAAAAAGCAATCAAAAACAAAAATAAATTAAAATCTACTTTC
AAATCAAGCAAGCATAAATGGGATTTTATTTAACCTTATTTTATAGATTTAAAGCAAGGT
ATTGTTCTAACTGGTAGCATATCATTTGGTGTTATTGGTAGTATAGTAGCAAATTTGGTT
TACAAAAATATTGAAAAGAAGAAAAAGAAAGATCAAGTTGAATATGATGGTTTCTTAGCA
GAATAAGAAGATGTGATTGAAGAAGAAATAGACTTCAAATACAGAGTTTCATCAAGAAAA
AAAACTGCTACAATTCATACTGACCCTGAAAATCTTAATATTGACAGGTAAAGACTCAAA
GTAAGTGCTAAGATTCACATTGATAATCATTTAATTGAAGAACTTAGATTCCTTGATTCT
CCTATATGTGAAATAGAAAGAGTCCATAATCTTATTATTGATAGAGGTTTGACTTAGATT
GATGATATAGTAACTAAAAAAGCAGAATCTATGCCTAAAGGAGCATTTATTTTCACAAAT
ACCTTTATCCTTAATAAGGTTGAATACGGCCCAACTTGCATGATTTAGTCAGCTAAAAGA
TGGCTCAGAGCTGGTCCTAGATATCATTTATATTTTTAACCTTAGGAAGTAAAAGCATTA
GTCCTTTCAGTAGGTAGTATAGTTCCAGGAATCAATGTAGTTATTAGGGAAATAGTGCGT
GCTCTTAATAATAATTATGGGGCAAATTAGGTTTTTGGTGCAAGATTTGGCTATAAAGGA
GTGATTGAGGAAAACTTCATAGATTTGAGTAAAAACTTAGCTGAAAATGTTCATTCCACT
GGAGGATCCTTTTTAGGAGTCTGTAGAGGTGGATTCAATTTGCATTTAATTCTAAAAGTT
TTGATTAAGCATGGATTTAACTAATTGTATATCATCGGTGGAGATGGAGCTATGAGAAGT
GCATAAGCACTTTTAATTGAAATATCTAAAAAAAAGCATAATATTGCTATATGTGTAATT
CCTAAAAGTGTCTAAGGTGATATCCCTATTGCTGAAGAATAAATGGGTTTTTAAACAACC
ATTGAAGAAACTGCAAAGGCTGTTGAAGCAGGATTTGTGGAAAGCTAATCTCATGAATAC
GGTATTGGTCTAATCAGATGCTTTGGTAGAAATGCTGGGTTTGTTGCAAGTCATGTTGCT
GAAGCCACTGGTTGTGTTGATGTTGTACTTGTGCCTGAGTTTTAATGGGATCTCTATGGA
GAAAAGGGTGTTTTGGAATACATTAGAAGCCAAATTAAAATTAAAAAGCATCTTATCATT
ATTGTTAGTGAGGGTTCAGTTAATAGCTTAAGAGATGTCCACTTACCTGAATTAGGAGAA
GATGAATCAGGAAATAAAATTTACATAAATATTGGTGAATTCTTAAAAGATAAAATCATC
CAATATTGTGAGGATAAAAAGTAACCAATAATCATCAAATTTATTGACCCTCTCTACATA
ACTAGGGCATGTAGAGCTAATCCACATGACACCAAGGTTTGCAGCTAAATGGCTTAAAAT
GCAGTTCATGGATGTATGGCAGGATTTACTGGATTTGCTGTAGTCATTGTGCATCATAAA
ACAGCTTTCGTTCCATTATCAGAAATGGTATCAGGAAATTATGAAAATAAATTGGTCCCT
CATAACAGACATTGGTAGAGAGTTTTATCATAAACCTTATAACCTTCTTTCATAAATAAT
GAAGAAGAGCACCTTAAATAATAAGAATAAGAGAACAAAGCTTTGTGA


>TTHERM_00338470(gene)
ATGAGTAATAGATAAGAGTAAAAAATTAGTTCAATCATTCAATTAATAACAATACTTATT
AGTATAAGAAGACGAATAATTAATTAATAAATTAATTAACATGAATTATTTCTAAATAAA
AGTGTGATCGGACTTCTATTATTAACTAAATCTTTAATTAGATACATACATACTGCTTTT
AATAAAATAAACTTAGAAAAAAAAGCAATCAAAAACAAAAATAAATTAAAATCTACTTTC
AAATCAAGCAAGCATAAATGGGTATTTAAATTATTATTTATTTTTGAATACTGATCAATA
GCTTTTATAGCCAAAATAACCATTTATCTAGATTATCTTAGGATTTTATTTAACCTTATT
TTATAGATTTAAAGCAAGGTATTGTTCTAACTGGTAGCATATCATTTGGTGTTATTGGTA
GTATAGTAGCAAATTTGGTTTACAAAAATATTGAAAAGAAGAAAAAGAAAGATCAAGTTG
AATATGATGGTTTCTTAGCAGAATAAGAAGATGTGATTGAAGAAGAAATAGACTTCAAAT
ACAGAGTTTCATCAAGAAAAAAAACTGCTACAATTCATACTGACCCTGAAAATCTTAATA
GTAAATTAAAATAAATTTTCAATTCTATTTTAGTTTTATAATTTGAATGCTAGTAAGCTG
AAAGCATAATATACAAAACAAACTAAATATACTGCAAAATCACTTTAGAACTAAAGAAAA
TAAAATAATATTTTGAACTGAAATATTTTTAAAAGAAAGCATGTGCATTTTTTTTATAAG
CGTTAAATAAAATTTCTTACAGCTTATATTTTTAAATAGCTTTTTTGTAATTCTAAAAAA
TAATAAATATAAAAATCGTTTTTAATTAATTAATGATTTAGTTTATTTGTTAATTTATTT
ATTTATTAAACAAATTTAATTAATTAGCTTTATATTTAAAATAAATATTATAAAGTTGAC
AGGTAAAGACTCAAAGTAAGTGCTAAGATTCACATTGATAATCATTTAATTGAAGAACTT
AGATTCCTTGATTCTCCTATATGTGAAATAGAAAGAGTCCATAATCTTATTATTGATAGA
GTATGATAAAAATGAATGAATAGGTTTAATTTGGTAACTTATTTTATTAATATAAAAAGG
GTTTGACTTAGATTGATGATATAGTAACTAAAAAAGCAGAATCTATGCCTAAAGGAGCAT
TTATTTTCACAAATACCTTTATCCTTAGTAAATATATTTGAAATAGAAAGTATTTTACTA
TAATTAAGTTAAAAATTAATAAAAAAATAAAAGATAAGGTTGAATACGGCCCAACTTGCA
TGATTTAGTCAGCTAAAAGATGGCTCAGAGCTGGTCCTAGATATCATTTATATTTTTAAC
CTTAGGAAGTAAAAGCATTAGTCCTTTCAGTAGGTAGTATAGTTCCAGGAATCAATGTAG
TTATTAGGGAAATAGTGCGTGCTCTTAATAATAATTATGGGGCAAATTAGGTTTTTGGTG
CAAGATTTGGCTATAAAGGAGTGATTGAGGAAAACTTCATAGATTTGAGTAAAAACTTAG
CTGAAAATGTTCATTCCACTGGAGGATCCTTTTTAGGAGTCTGTAGAGGTGGATTCAATT
TGCATTTAATTCTAAAAGTTTTGATTAAGCATGGATTTAACTAATTGTATATCATCGGTG
GAGATGGAGCTATGAGAAGTGCATAAGCACTTTTAATTGAAATATCTAAAAAAAAGCATA
ATATTGCTATATGTGTAATTCCTAAAAGTGTCTAAGGTGATATCCCTATTGCTGAAGAAT
AAATGGGTTTTTAAACAACCATTGAAGTAAAACATTTAAAGTATAATTAAATATTCTAAA
AAATTTATTTTCATTTTTAGGAAACTGCAAAGGCTGTTGAAGCAGGATTTGTGGAAAGCT
AATCTCATGAATACGGTATTGGTCTAATCAGATGCTTTGGTAGAAATGCTGGGTTTGTTG
CAAGTCATGTTGCTGAAGCCACTGGTTGTGTTGATGTTGTACTTGTGCCTGAGTTTTAAT
GGGATCTCTATGGAGAAAAGGGTGTTTTGGAATACATTAGAAGCCAAATTAAAATTAAAA
AGCATCTTATCATTATTGTTAGTGAGGGTTCAGGTAAAAATTATATTTCATTGTGTTGTA
AAAATAAAATTATTGGTTACTGATAAATTAGTTAATAGCTTAAGAGATGTCCACTTACCT
GAATTAGGAGAAGATGAATCAGGAAATAAAATTTACATAAATATTGGTGAATTCTTAAAA
GATAAAATCATCCAATATTGTGAGGATAAAAAGTAACCAATAATCATCAAATTTATTGAC
CCTCTCTACATAACTAGGGCATGTAGAGCTAATCCACATGACACCAAGGTTTGCAGGTAT
AAAAATTTTTTGAGAATTGATTTTTTTTAAAAGAATTAAATAAATTAATAGCTAAATGGC
TTAAAATGCAGTTCATGGATGTATGGCAGGATTTACTGGATTTGCTGTAGTCATTGTGCA
TCATAAAGTAAATAAAATTTATAAAATAAATCATATTTAATGATAAAATTTAAATTTTTT
AATAGACAGCTTTCGTTCCATTATCAGAAATGGTATCAGGAAATTATGAAAATAAATTGG
TCCCTCATAACAGACATTGGTAGAGAGTTTTATCATAAACCTTATAACCTTCTTTCATAA
ATAATGAAGAAGAGCACCTTAAATAATAAGAATAAGAGAACAAAGCTTTGTGA


>TTHERM_00338470(protein)
MSNRQEQKISSIIQLITILISIRRRIINQQINQHELFLNKSVIGLLLLTKSLIRYIHTAF
NKINLEKKAIKNKNKLKSTFKSSKHKWDFIQPYFIDLKQGIVLTGSISFGVIGSIVANLV
YKNIEKKKKKDQVEYDGFLAEQEDVIEEEIDFKYRVSSRKKTATIHTDPENLNIDRQRLK
VSAKIHIDNHLIEELRFLDSPICEIERVHNLIIDRGLTQIDDIVTKKAESMPKGAFIFTN
TFILNKVEYGPTCMIQSAKRWLRAGPRYHLYFQPQEVKALVLSVGSIVPGINVVIREIVR
ALNNNYGANQVFGARFGYKGVIEENFIDLSKNLAENVHSTGGSFLGVCRGGFNLHLILKV
LIKHGFNQLYIIGGDGAMRSAQALLIEISKKKHNIAICVIPKSVQGDIPIAEEQMGFQTT
IEETAKAVEAGFVESQSHEYGIGLIRCFGRNAGFVASHVAEATGCVDVVLVPEFQWDLYG
EKGVLEYIRSQIKIKKHLIIIVSEGSVNSLRDVHLPELGEDESGNKIYINIGEFLKDKII
QYCEDKKQPIIIKFIDPLYITRACRANPHDTKVCSQMAQNAVHGCMAGFTGFAVVIVHHK
TAFVPLSEMVSGNYENKLVPHNRHWQRVLSQTLQPSFINNEEEHLKQQEQENKAL