Identifiers and Description

Gene Model Identifier

TTHERM_00339620

Standard Name

RPL40 (Ribosomal Protein of the Large Subunit #40)

Aliases

PreTt06103 | 34.m00340 | 3689.m00134

Description

RPL40 ubiquitin/ribosomal fusion protein putative; Homolog of Yeast RPL40; RPL40-Ubiquitin fusion protein; Ribosomal L40e family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_15096.1 1.000211181581171e-120
Description: ribosomal L40e family protein (174 aa)
SGD YKR094C 9.996373193201036e-79
Description: RPL40B Fusion protein, identical to Rpl40Ap, that is cleaved to yield ubiquitin and a ribosomal protein of the large (60S) ribosomal subunit with similarity to rat L40; ubiquitin may facilitate assembly of the ribosomal protein into ribosomes
WormBase WBGene00006728 3.000074895537278e-78
Description: locus:ubq-2 Ubiquitin-60S ribosomal protein L40 status:Confirmed UniProt:P49632 protein_id:CAB04967.1
Oxytricha Contig12690.0.g68 1.9998099689916736e-77
Description: Ubiquitin family
DictyBase DDB_G0280755 2.0007889996237956e-71
Description: ubqB on chromosome: 3 position 3722395 to 3722781
Stentor Coeruleus SteCoe_28302 3.6251409191435593e-34
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00339620(coding)
ATGAATGAAGTGAGAAATAAGAGAAGGTAAATATTGATTAGATATAAAAAAGATCTAAGG
ATAAAAAACCAAAATAAAGAAATCAAAAATTATTAAATCAAAAAAAAAGAAATTAAAAGA
AGAAAAAAGGAAATGTAAATTTTCGTTAAGACTTTAACTGGTAAGACCATTACCTTAGAC
GTTGAAGCCTCCGACACTATTGAAAATGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCCGGTAAGCAATTGGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTTTTGAGATTAAGAGGTGGT
GGTATGGAACCCACTATTGCTGCTCTTGCTAAGAAGTACAACTGCGAAAAGAAGGTTTGC
AGAGACTGTTATGCTAGATTACCCCCCAAAGCTACCAACTGCAGAAAGAGAAAGTGCGGT
CACTCCAACTCCCTTAGATTGAAGAAGAAACCCAAAGAGTGA


>TTHERM_00339620(gene)
ATGAATGAAGTGAGAAATAAGAGAAGGTAAATATTGATTAGATATAAAAAAGATCTAAGG
ATAAAAAACCAAAATAAAGAAATCAAAAATTATTAAATCAAAAAAAAAGAAATTAAAAGA
AGAAAAAAGGAAATGTAAATTTTCGTTAAGACTTTAACTGGTAAGACCATTACCTTAGAC
GTTGAAGCCTCCGACACTATTGAAAATGTCAAGGCTAAGATCCAAGATAAGGAAGGTATC
CCCCCTGATCAATAAAGACTTATCTTCGCCGGTAAGCAATTGGAAGACGGCAGAACCCTT
TCTGACTACAACATCCAAAAGGAATCTACCCTCCACTTAGTTTTGAGATTAAGAGGTGGT
GGTATGGAACCCACTATTGCTGCTCTTGCTAAGAAGTACAACTGCGAAAAGAAGGTTTGC
AGAGACTGTTATGCTAGATTACCCCCCAAAGCTACCAACTGCAGAAAGAGAAAGTGCGGT
CACTCCAACTCCCTTAGATTGAAGAAGAAACCCAAAGAGTGA


>TTHERM_00339620(protein)
MNEVRNKRRQILIRYKKDLRIKNQNKEIKNYQIKKKEIKRRKKEMQIFVKTLTGKTITLD
VEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG
GMEPTIAALAKKYNCEKKVCRDCYARLPPKATNCRKRKCGHSNSLRLKKKPKE