Identifiers and Description

Gene Model Identifier

TTHERM_00343680

Standard Name

PRP11 (Pre-mRNA Processing factor 11)

Aliases

PreTt26147 | 35.m00208 | 3695.m00041

Description

PRP11 splicing factor 3A subunit 2; Spliceosome associated protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14698.1 2.0001055857497602e-161
Description: spliceosome associated protein (230 aa)
Oxytricha Contig15681.0.g15 1.9998521972819316e-89
Description: Zinc-finger of C2H2 type
WormBase WBGene00008683 2.0006821221283624e-88
Description: locus:repo-1 status:Confirmed UniProt:Q19335 protein_id:CAA92593.2
DictyBase DDB_G0293876 9.996373193201036e-79
Description: sf3a2 on chromosome: 6 position 3412404 to 3413152
Stentor Coeruleus SteCoe_8302 1.3336148155022614e-34
Description: None
SGD YDL043C 0.000000000000001999258566166494
Description: PRP11 Subunit of the SF3a splicing factor complex, required for spliceosome assembly

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00343680(coding)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA


>TTHERM_00343680(gene)
ATGGTGGATAGATAACACAGACCAGGTGCTAAGACTGGTTCAGGAGGACCTGCTTCTTCT
TAAGATGCCAATATTGAGCACAGAGAAAGACTGAAAAAGCTAGCCTTAGAAACAATAGAT
ATTAAGAAGGATCCTTATTTCATGACAAATCACTTGGGTACTTATGAATGCAGATTGTGT
CTAACTCTGCACACAAACGAAGGTAGTTATTTAGCTCACACATAAGGTAAAAAGCATCAA
ACTAATTTATAAAGAAGATAAAGCAAAGAACGCTAAGAACAGAATATACAGTTGCAGCAA
AACTAAACAAAAGGGCTACAAAAGAAGAAAACCATCAAAATTGGAAGACCTGGATATAAA
ATTTTTAAGATGATTGATCCAACTTCTGGATAAAAGTAGATAACTTTTGAGATAGATTAT
GAGTAAATAGATGCCAGTTGGAAACCCTTTTATAGAATTATGAGTTCTTACGAGTAAAAA
GTAGAGTAGTTTGATAAAAATTATTAATATGTAGTCTTTGCCGCTGAGCCATATGATAAC
ATAGCCTTTAAAATACCAAATATGGAAATAGATATGGAAGAAGGGAAGTTTTACTAAGAT
TGGAATAAAGATAAGAAGAAATACACACTCCATTTAACATTTAAAGATAGACAAAATAAA
TAATCAAGAAATCAAAAGAATTGA


>TTHERM_00343680(protein)
MVDRQHRPGAKTGSGGPASSQDANIEHRERLKKLALETIDIKKDPYFMTNHLGTYECRLC
LTLHTNEGSYLAHTQGKKHQTNLQRRQSKERQEQNIQLQQNQTKGLQKKKTIKIGRPGYK
IFKMIDPTSGQKQITFEIDYEQIDASWKPFYRIMSSYEQKVEQFDKNYQYVVFAAEPYDN
IAFKIPNMEIDMEEGKFYQDWNKDKKKYTLHLTFKDRQNKQSRNQKN