Identifiers and Description

Gene Model Identifier

TTHERM_00353420

Standard Name

Aliases

PreTt05356 | 36.m00320 | 3703.m00179 | THK1

Description

Serine/Threonine kinase domain protein; Protein kinase domain containing protein. Sequence similarity to the DYRK2 protein kinase subfamily (Eisen et al.- 2006).

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07196 ) Flagellin hook IN motif
  • ( PF07714 ) protein tyrosine kinase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09851.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (1180 aa)
Oxytricha Contig21921.0.g12 8.996715803925261e-157
Description: Protein kinase domain
WormBase WBGene00003150 1.999149254372995e-126
Description: locus:mbk-2 status:Confirmed UniProt:Q9XTF3 protein_id:CCG28133.1
DictyBase DDB_G0293750 2.000127961544401e-120
Description: dyrk2 on chromosome: 6 position 3272270 to 3275238
SGD YJL141C 3.9983507938127826e-75
Description: YAK1 Serine-threonine protein kinase; component of a glucose-sensing system that inhibits growth in response to glucose availability; upon nutrient deprivation Yak1p phosphorylates Pop2p to regulate mRNA deadenylation, the co-repressor Crf1p to inhibit transcription of ribosomal genes, and the stress-responsive transcription factors Hsf1p and Msn2p; nuclear localization negatively regulated by the Ras/PKA signaling pathway in the presence of glucose
Stentor Coeruleus SteCoe_26787 9.710436457780846e-67
Description: None

General Information

No. Gene Name(s) Paragraph Text
122 (no standard gene name) Tetrahymena thermophila’s THK1 protein is homologous with protein kinases. It has three domains: Protein kinase domain (E-value = 2.7E-54), Flagellin hook IN motif (E-value = 6.7E-13), and Tyrosine kinase (E-value = 1.30E-93). The first and third domains contain the catalytic function of protein kinases, which phosphorylate proteins. The second domain does not yet have a determined function, but it is located in many flagellar hook proteins. The closest homologs are in Paramecium tetraurelia strain d4-2, a freshwater protest, Ichthyophthirius multifiliis, a freshwater spot disease, and Vitrella brassicaformis CCMP3155. It is possible this protein functions as a tyrosine kinase . Paragraph by Lynnlee Duck-Reynolds and Ann Ly (undergraduates), Keck Science Center, Scripps College.

Associated Literature

  1. Ref:16933976: Eisen JA, Coyne RS, Wu M, Wu D, Thiagarajan M, Wortman JR, Badger JH, Ren Q, Amedeo P, Jones KM, Tallon LJ, Delcher AL, Salzberg SL, Silva JC, Haas BJ, Majoros WH, Farzad M, Carlton JM, Smith RK, Garg J, Pearlman RE, Karrer KM, Sun L, Manning G, Elde NC, Turkewitz AP, Asai DJ, Wilkes DE, Wang Y, Cai H, Collins K, Stewart BA, Lee SR, Wilamowska K, Weinberg Z, Ruzzo WL, Wloga D, Gaertig J, Frankel J, Tsao CC, Gorovsky MA, Keeling PJ, Waller RF, Patron NJ, Cherry JM, Stover NA,

Sequences

>TTHERM_00353420(coding)
ATGCAATTTTATAATCCTAACTCATCATCATCTGCATCTAAAAATTCTAACATAAAGGTG
CAATAAAACCTCAATAACTCTCAACTGAATAATGCACTGTCTCCAAAGAAATATAAATAG
AAGAACATATCGTTGGATTTAGGTTCTAGAAAAATATCTCCATTGGATAATAGTTTAAGA
AAAAGGATAGAATATTAGCGTGATAGTAAATAAAGCATTAAGCAGCCAAAGTTAACATTA
AACACAAGCTCTCATAATAACACATGTAATTTAAGTAATAATTAAAGTTTTGCTTAAAGT
ACAAAGCACTACTAAGGTAATTCTTCGATTCACATATCTGGTGAAAAGACTCTAACCTAG
CCTAATGTGAATCCATCTGGCGGAATAAATACAAATACAGCAAGCAATGTGAATAATAGC
AACAGTTTAATCATAAACCATATCCTTGACTCCACTAAAAGTCAAGGTGGGACAATCAAT
ATAAATGCAAACAATATATCGTTTCATAATTAATACAACATAACTAATTTAGTGTCTTAA
ATGAATAGAAAAAGATAGCCTATTGGAGGAAATGTGATAGTAAATAATAGTGTTGGATAA
AATACAATGATTTCGAATAATATAAATTAATTAAGTGCAAATGTATAAAATCTTAACAAC
ATCCTAAATTATTAAAACAGTGGAGCTTCTACTGCAACTAACAGCAACGCACCTAGAAGC
ATATAATTTCATTAATATGGTGCACCAAATTCTACAAATAAAGTTAATAGCAGTTTTAAT
TAGTTCAATTAAGGAGGTTAAACAAATAATTTTATGAATTTGAGTTCTGTTTCTACCAGT
TAGAATGCTTAAGTAAATAACTCGTAACATATCAACAATAATAATAATGGAAGCAATCCA
ATAAGAAGATCTAAATATAAAATAAACACTGAAACAATTAATACACAAAATGATTATTCT
CTAACGATAGACCACTCTGGAGGTTCTATCCCTCGCTATCCTCAAACGGAAACTCACAAA
ACAGGGACAAAAGAAATAATTATCCCTTAATCAAATAAAATAGAGTAAATTTCTAATAGA
TATAATCTAACTTCTACAAATAAGCCTAACTCTAGAATGCATCTTATGATAGGTACAGAA
AACGATCAATCTTAAAATTAAATGGGAGGATTAAAAGACTTCCTTTCTCCACAAGGTGCA
GCTTTCATAAAATCAAATGTATCAAGTAAGAGCACTTAAAGAAATTACTCAAATAAAAAT
AGATACTTAGGTTTAAATAAAATACAAGCTCAATAATAAAACTCATCTCAATCAAGAGTT
AGAAGTAATATAAAATAAATGAGCAAAGATAAAGCACTTTCAGTAGATAAAACCTCTAAT
TACATAAATCGTCGTGACTCTACTTAAAATTAAAATGGAAATTATATTCAAGATAAGTCT
TCATTATTGTAAACATTATAGCCTCCAGCATCTCAAAGCTATGACCAAGGAGGAGATAAT
GCTTACTATAAACATAATACTTTGTAAGATGAGCAACTAGGAAGCACATATTATACAATA
GATAATTAAAACTTGCAATAACCTACAATTTAGTCTTCAGGTAGCTCTAAATTAGAAGAA
AAGCATTTAACTTGGGAAGATCTTAAACTCCCTGTAGGTCCTGATGATGTCTTAAACAAG
TATGGACATGAATTCCTCACAGATTATGAAAAAAAAGAAATATTATAATACATGAATATT
TATTATGTAGGTCACAAGGCCAAAAAACCAGCTAGATCAGAAATCTAATAAGCTAATTCA
TACAATTTCGGATATGATGATGAAAAAGGAGACTATCTTTATACATTAAATGATCACATT
GCTTACAGATATGAGCTGATTGAGGCTTTGGGTAAGGGATCTTTTGGACAGGTTATAAAA
GTGTTTGATCATAAAAGAAAAGAATACTCAGCTTTGAAAATTATAAGAAATAAAAAGAAT
TTTTATAATTAAGCAATTGTAGAACTAAATATATTAAAATATATAAAAGACAACGACCCT
TAAAATTAAACGAATATTGTTAAAATTAAAGACTTTGTGATATTTAGGAGCCATGTGTGT
ATTGTTTTCGAGCTACTTAGTATCAATCTTTATGAATTTTTGAAGAATAATAAATTTAAT
GGGGTTTCTTTAGAACTGATCAGGAGGTTTGCTATTTAAATTTTATAGGGATTGCTTTTT
TTAACAAAAGCGAATATTATTCATTGTGATTTGAAACCAGAAAATATTTTACTTAAGCAG
GAAAATAAATCAGGTATTAAGATTGTTGATTTTGGATCAAGCTGCTTTGAGAACTAGAGA
GTTTATACTTATATTCAAAGCAGGTTTTATAGAGCTCCCGAAATTATTTTAGGCTTACCC
TATGGAAAGGCTATAGACATGTGGAGCTTTGGGTGTATTATGGCTGAGCTGTATATTGGT
TATCCTTTATTTCCTGGGGAGAACGAAGCTGAATAATTTTAAATGTTTATGGAGATACTA
GGAATACCAGAAGAAGAATTTGTTGAAAATTGTCCTAGGAGAAATGTGTTTTTTGAAAAT
AATAAAACACCTAAAGTTGTCAAAAATTCTAGAGGTAAAATAAGAACTCCAGCTACTAAG
CACATAAATTACTATCTCCGCTGTCCTGATGAAAATTTTATTGATTTTGTTTCAAAGTGC
TTTACTTGGAAAAATCACGAAAGAATGTCGCCTGCTGAAGCCCTCGTTCACGATTGGATT
TTAGAAGGATTGCCAGAGGAAATCAGGGCTTAGCATCTATAATAAATGCAACAAACATCT
CCTGAAATAGACATGAGAGCTAAATTTAAAAAATATAAAATTGCATGGATTCCTCCTCCA
AATCTCCAAGTATTTAAAGGAAAAATTCCCTCAGCTCCTCCTTAACAACAATATTCAAAT
AAACAAGCAAAATCACAATCCAGTAATAAAGCAAATACGATTGAAGATTAACCTTAAAAT
AATGAAAATACAAGTGGAGTTGGATAAGGGAGAAATAGCTTTAAAAAGGCTGAAATGAAT
AACTCAAGCAGCTTTGGACCTTCAGTGGTAAGCGTAAATACTGGCCTTTAAGAGAGAAAT
AAAAATATAATTAATTCGCAGTCTCATCAAATATAAGATGTAAAGATAAATCCATAATCT
TAAGCGAGTAATCCTTCTTCATCTTCTTGCTAAAATGCGATAAATAAATATGGATAAAAA
TAAAATAATGCAAAAAATTATGTTTTTAAAAATTAAAATCCACTAAATAGTGTTACAAAT
AATTAACCTCTATCTCAATCTAAGATCGAATAAGCTGAAAACCCTTCTTCAAATAATCTT
TCATAAATTCCATTAAATTAAGGAATATCTTTATAAAATAATAAAAAGAAGACAGACATG
ATACACTTAAGTGATTTTAATCCATATGAATCTGATCAATTTTCAAATACATTTTCTGCA
GCGACAACAACAAATGCCAAAAAAACTTAACAATAATTTGGATTTGTGCAAAATAACACT
CCTTAGCATCAAAATTTAAACGGAATTAAAGCAAATAATTTCCTTTAGCAAGGAAATTCT
TAGAACCAATCAATTTACCCAAATTAAATTAAAATAAGAAGACCTGATTCTTCCAAAAAA
AATAAAATAGAATAAAATTTTGTTGCTAATGAAGATCTGTAAAAAAACTCAAATCTCCAA
ATACAAAGTGGGGAAAATTGA


>TTHERM_00353420(gene)
ATGCAATTTTATAATCCTAACTCATCATCATCTGCATCTAAAAATTCTAACATAAAGGTG
CAATAAAACCTCAATAACTCTCAACTGAATAATGCACTGTCTCCAAAGGTAAATCTTAGT
TTGTTTCATAAAATCAAAGCTTACATAAAATATTTTAAGTTGCAGATTAATTACTATTAA
TACTTTATAATAGTTGATCTTATTAGCGGTTGCCTTTTCTTATTAAAGAGGAAATTTTTA
TCAATAATCGTTAAAATACATTTTAATCTGAAATAGCAAATTAATGCATTGATTTATATG
TAATAATTTTTGATTTTTTTTGTTTAAAGAAATATAAATAGAAGAACATATCGTTGGATT
TAGGTTCTAGAAAAATATCTCCATTGGATAATAGTTTAAGAAAAAGGATAGAATATTAGC
GTGATAGTAAATAAAGCATTAAGCAGCCAAAGTTAACATTAAACACAAGCTCTCATAATA
ACACATGTAATTTAAGTAATAATTAAAGTTTTGCTTAAAGTACAAAGCACTACTAAGGTA
ATTCTTCGATTCACATATCTGGTGAAAAGACTCTAACCTAGCCTAATGTGAATCCATCTG
GCGGAATAAATACAAATACAGCAAGCAATGTGAATAATAGCAACAGTTTAATCATAAACC
ATATCCTTGACTCCACTAAAAGTCAAGGTGGGACAATCAATATAAATGCAAACAATATAT
CGTTTCATAATTAATACAACATAACTAATTTAGTGTCTTAAATGAATAGAAAAAGATAGC
CTATTGGAGGAAATGTGATAGTAAATAATAGTGTTGGATAAAATACAATGATTTCGAATA
ATATAAATTAATTAAGTGCAAATGTATAAAATCTTAACAACATCCTAAATTATTAAAACA
GTGGAGCTTCTACTGCAACTAACAGCAACGCACCTAGAAGCATATAATTTCATTAATATG
GTGCACCAAATTCTACAAATAAAGTTAATAGCAGTTTTAATTAGTTCAATTAAGGAGGTT
AAACAAATAATTTTATGAATTTGAGTTCTGTTTCTACCAGTTAGAATGCTTAAGTAAATA
ACTCGTAACATATCAACAATAATAATAATGGAAGCAATCCAATAAGAAGATCTAAATATA
AAATAAACACTGAAACAATTAATACACAAAATGATTATTCTCTAACGATAGACCACTCTG
GAGGTTCTATCCCTCGCTATCCTCAAACGGTAAAAATTAAATTTTTGATTTACAAATAAA
AAGCAGCAATTTTTTTTTGCTAATAAGATAGAAAGATATAACTAAAAACTAAATAATTTT
ATTGGTAATTTTTATAGTACTAAATAAATTTGATTCTTAATATGTTAAGATAGTGTAAAA
GAAAAACAAACTAAGAAAATATTACTCTAACGAATAAACTATTTACTTCAATAATCATTA
TTTATTAAAATAATAAAATATATATAAAAATATTTAAATTAAAAAACTATCAATTAATTT
CTATCTGCTGTAAATTTGATATAAGATTATTTATTTTTTTGATTAATTTTAACGAATTTC
TCTTATTAATTTAAATAGGAAACTCACAAAACAGGGACAAAAGAAATAATTATCCCTTAA
TCAAATAAAATAGAGTAAATTTCTAATAGATATAATCTAACTTCTACAAATAAGCCTAAC
TCTAGAATGCATCTTATGATAGGTACAGAAAACGATCAATCTTAAAATTAAATGGGAGGA
TTAAAAGGTAGTTTATGATTTAAACATTTTATAGCTATTACTATTCCAAATTAATTTAAA
ATTTCATTACAAAGATAAGTATTTTTTGATATTTTAAGTGAATTAAATAATACTTTAATT
TAATTAAATTAAACAAACAATAAAATTTTAATAAAAAATTATATTATAATATAGACTTCC
TTTCTCCACAAGGTGCAGCTTTCATAAAATCAAATGTATCAAGTAAGAGCACTTAAAGAA
ATTACTCAAATAAAAATAGATACTTAGGTTTAAATAAAATACAAGCTCAATAATAAAACT
CATCTCAATCAAGAGTTAGAAGTAATATAAAATAAATGAGCAAAGATAAAGCACTTTCAG
TAGATAAAACCTCTAATTACATAAATCGTCGTGACTCTACTTAAAATTAAAATGGAAATT
ATATTCAAGATAAGTCTTCATTATTGTAAACATTATAGCCTCCAGCATCTCAAAGCTATG
ACCAAGGAGGAGATAATGCTTACTATAAACATAATACTTTGTAAGATGAGCAACTAGGAA
GCACATATTATACAATAGATAATTAAAACTTGCAATAACCTACAATTTAGTCTTCAGGTA
GCTCTAAATTAGAAGAAAAGCATTTAACTTGGGAAGATCTTAAACTCCCTGTAGGTCCTG
ATGATGTCTTAAACAAGTATGGACATGAATTCCTCACAGATTATGAAAAAAAAGAAATAT
TATAATACATGAATATTTATTATGTAGGTCACAAGGCCAAAAAACCAGCTAGATCAGAAA
TCTAATAAGCTAATTCATACAATTTCGGATATGATGATGAAAAGTAAAATAAAATAAAAT
TCAAGTTTTTACTTTTTTACAATAAATTTGTATTTGAATTTCTAATTTATTGTAAATTTA
TTTTATTAACTTCCAAATAAATAAATGAGCTCAATTACTATTAAAATTGAATTATAAAAT
TTAAAATATCAACATTTTATTTACTTCATCAAATCGATAATAAAAAATATTTAATTAATT
AATTTCGTAAAATTTAGTTTATTTTGTTAGATTAAAAATACTAAAAATATTTGATAAGAG
TATGATTTAATAATGAGTCTTTAAAAATATTATTTAATAATAAAAAGAGGAGACTATCTT
TATACATTAAATGATCACATTGCTTACAGATATGAGCTGATTGAGGCTTTGGGTAAGGGA
TCTTTTGGACAGGTTATAAAAGTGTTTGATCATAAAAGAAAAGAATACTCAGCTTTGAAA
ATTATAAGAAATAAAAAGAATTTTTATAATTAAGCAATTGTAGAACTAAATATATTAAAA
TATATAAAAGACAACGACCCTTAAAATTAAACGAATATTGTTAAAATTAAAGACTTTGTG
ATATTTAGGAGCCATGTGGTAATCAATCAATCATTTATTTTATTAAAATTATTTATTTAG
AGATTTATTTAGTGACATATATAGATTAATTTTAACTTCTACTTTGAATAAATCTAAATT
TTTTATTTTTAAATAAAGTGTATTGTTTTCGAGCTACTTAGTATCAATCTTTATGAATTT
TTGAAGAATAATAAATTTAATGGGGTTTCTTTAGAACTGATCAGGAGGTTTGCTATTTAA
ATTTTATAGGGATTGCTTTTTTTAACAAAAGCGAATATTATTCATTGTGATTTGAAACCA
GAAAATATTTTACTTAAGCAGGAAAATAAATCAGGTATTAAGATTGTTGATTTTGGATCA
AGCTGCTTTGAGAACTAGAGAGTTTATACTTATATTCAAAGCAGGTTTTATAGAGCTCCC
GAAATTATTTTAGGCTTACCCTATGGAAAGGCTATAGACATGTGGAGCTTTGGGTGTATT
ATGGCTGAGCTGTATATTGGTAATTAAACCATTTAAAAATCAAACCATTTTTTAAATTAA
AAAATTAATACTTCAAAAGGTTATCCTTTATTTCCTGGGGAGAACGAAGCTGAATAATTT
TAAATGTTTATGGAGATACTAGGAATACCAGAAGAAGAATTTGTTGAAGTAAATTTTTAT
TTGATAAAAGTCAAGTAAATATATAAGTTATTTAATTAAATAAACATTTTTTAAAAATAA
GAATTGTCCTAGGAGAAATGTGTTTTTTGAAAATAATAAAACACCTAAAGTTGTCAAAAA
TTCTAGAGGTAAAATAAGAACTCCAGCTACTAAGCACATAAATTACTATCTCCGCTGTCC
TGATGAAAATTTTATTGATTTTGTTTCAAAGTGCTTTACTTGGAAAAATCACGAAAGAAT
GTCGCCTGCTGAAGCCCTCGTTCACGATTGGATTTTAGAAGGATTGCCAGAGGAAATCAG
GGCTTAGCATCTATAATAAATGCAACAAACATCTCCTGAAATAGACATGAGAGCTAAATT
TAAAAAATATAAAATTGCATGGATTCCTCCTCCAAATCTCCAAGTATTTAAAGGAAAAAT
TCCCTCAGCTCCTCCTTAACAACAATATTCAAATAAAGTAAATATAAAATAATTTTTTAT
TCAATATTAATGTATTTTCATAACTATATTAGCAAGCAAAATCACAATCCAGTAATAAAG
CAAATACGATTGAAGATTAACCTTAAAATAATGAAAATACAAGTGGAGTTGGATAAGGGA
GAAATAGCTTTAAAAAGGCTGAAATGAATAACTCAAGCAGCTTTGGACCTTCAGTGGTAA
GCGTAAATACTGGCCTTTAAGAGAGAAATAAAAATATAATTAATTCGCAGTCTCATCAAA
TATAAGATGTAAAGATAAATCCATAATCTTAAGCGAGTAATCCTTCTTCATCTTCTTGCT
AAAATGCGATAAATAAATATGGATAAAAATAAAATAATGCAAAAAATTATGTTTTTAAAA
ATTAAAATCCACTAAATAGTGTTACAAATAATTAACCTCTATCTCAATCTAAGATCGAAT
AAGCTGAAAACCCTTCTTCAAATAATCTTTCATAAATTCCATTAAATTAAGGAATATCTT
TATAAAATAATAAAAAGAAGACAGACATGATACACTTAAGTGATTTTAATCCATATGAAT
CTGATCAATTTTCAAATACATTTTCTGCAGCGACAACAACAAATGCCAAAAAAAGTAAAA
TCACTAGTATTATTTATAATTTATCAAATTAAATCTTCCATTTTATTTAAAAGCTTAACA
ATAATTTGGATTTGTGCAAAATAACACTCCTTAGCATCAAAATTTAAACGGAATTAAAGC
AAATAATTTCCTTTAGCAAGGAAATTCTTAGAACCAATCAATTTACCCAAATTAAATTAA
AATAAGAAGACCTGATTCTTCCAAAAAAAATAAAATAGAATAAAATTTTGTTGCTAATGA
AGATCTGTAAAAAAACTCAAATCTCCAAATACAAAGTGGGGAAAATTGA


>TTHERM_00353420(protein)
MQFYNPNSSSSASKNSNIKVQQNLNNSQLNNALSPKKYKQKNISLDLGSRKISPLDNSLR
KRIEYQRDSKQSIKQPKLTLNTSSHNNTCNLSNNQSFAQSTKHYQGNSSIHISGEKTLTQ
PNVNPSGGINTNTASNVNNSNSLIINHILDSTKSQGGTININANNISFHNQYNITNLVSQ
MNRKRQPIGGNVIVNNSVGQNTMISNNINQLSANVQNLNNILNYQNSGASTATNSNAPRS
IQFHQYGAPNSTNKVNSSFNQFNQGGQTNNFMNLSSVSTSQNAQVNNSQHINNNNNGSNP
IRRSKYKINTETINTQNDYSLTIDHSGGSIPRYPQTETHKTGTKEIIIPQSNKIEQISNR
YNLTSTNKPNSRMHLMIGTENDQSQNQMGGLKDFLSPQGAAFIKSNVSSKSTQRNYSNKN
RYLGLNKIQAQQQNSSQSRVRSNIKQMSKDKALSVDKTSNYINRRDSTQNQNGNYIQDKS
SLLQTLQPPASQSYDQGGDNAYYKHNTLQDEQLGSTYYTIDNQNLQQPTIQSSGSSKLEE
KHLTWEDLKLPVGPDDVLNKYGHEFLTDYEKKEILQYMNIYYVGHKAKKPARSEIQQANS
YNFGYDDEKGDYLYTLNDHIAYRYELIEALGKGSFGQVIKVFDHKRKEYSALKIIRNKKN
FYNQAIVELNILKYIKDNDPQNQTNIVKIKDFVIFRSHVCIVFELLSINLYEFLKNNKFN
GVSLELIRRFAIQILQGLLFLTKANIIHCDLKPENILLKQENKSGIKIVDFGSSCFENQR
VYTYIQSRFYRAPEIILGLPYGKAIDMWSFGCIMAELYIGYPLFPGENEAEQFQMFMEIL
GIPEEEFVENCPRRNVFFENNKTPKVVKNSRGKIRTPATKHINYYLRCPDENFIDFVSKC
FTWKNHERMSPAEALVHDWILEGLPEEIRAQHLQQMQQTSPEIDMRAKFKKYKIAWIPPP
NLQVFKGKIPSAPPQQQYSNKQAKSQSSNKANTIEDQPQNNENTSGVGQGRNSFKKAEMN
NSSSFGPSVVSVNTGLQERNKNIINSQSHQIQDVKINPQSQASNPSSSSCQNAINKYGQK
QNNAKNYVFKNQNPLNSVTNNQPLSQSKIEQAENPSSNNLSQIPLNQGISLQNNKKKTDM
IHLSDFNPYESDQFSNTFSAATTTNAKKTQQQFGFVQNNTPQHQNLNGIKANNFLQQGNS
QNQSIYPNQIKIRRPDSSKKNKIEQNFVANEDLQKNSNLQIQSGEN