Identifiers and Description

Gene Model Identifier

TTHERM_00353440

Standard Name

RRM12 (RNA Recognition Motif-containing protein 12)

Aliases

PreTt05358 | 36.m00322 | 3703.m00181

Description

RRM12 transmembrane protein putative

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,
  • ( PF05672 ) E-MAP-115 family
  • ( TIGR01622 ) splicing factor, CC1-like family

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_09853.1 1.0002124404074584e-26
Description: hypothetical protein (578 aa)

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00353440(coding)
ATGAAAATAAATTTTAATTTAATATTTATTTATTCATTTTTATATTCATATTCCAAATTA
TATATAGCCTGTATATTTATTATAAAAACTTCTTTCTTTCTTACTCCAATCTTTTAAATT
ACAGGCACACTTTTAATTAATTTCAAACTATTTAAATAAATTTTAATTACAATAAAAAAT
TCCTTGATTGAAATGGAAAAAAATTAGAATGACCTTTAGGCAATTTATAACTTAGTATCT
AAAAGATACCTGTAGCTCAAGAGAGAAAGTAAAAGCATAAAGTAAGAATATCAGAGTCCT
TTAAATAACTCTGATGAAGATTCAATAAACACCAGGAGTTGCTTAAAGCATAAAATTGAT
TCAAAGAACAAATCATACTTCAGTAGTAAGAAACAATTAGTCTCACAGTAAGAATTCAAA
AACTACTAAGATGAATATAAAAAAGCTTTTATTGGAAGAGAAAAGGCATTTTACATCAAA
TATAAAAATGATTTAAATGCAATTAAATTTTTAAAACACTGCCTATTTAGCCAAATAAAC
TAGTTAGATTTCAGCTAGTGTGTGTAGGGAAATAACTTATGCCTACAAAAAAAGGATTTA
AGAACTAGAATGAAAGAAGTTTATTCATATATAAATCAAAAACAAATTATGGTGTTTCTT
ATTTTAGGACTAGTTATGTTTGGATACAATTTATGGAACTAGTATCAAGAAATCATAATA
GAAAAGAAGACTTTGGATGAGTTTAGGTTAAGGTATGAAAACGAAAGTGAAGCTTTGTAT
TAGATTTTAAAACAAAAACATGCTCTCTATGAAAAAATAAAAAGGCACAAAGATTTTGGG
ATAATTTAATCATTGCTAAATAGATAAATCAAGCTAAAATTTTCTTTTATTTTTGGAGTA
CTTTCTTTACTGCTGAGTCTATTCAAAGCACTATTTTACCACTTTTCTCATAATAAAATA
AGACCTATGCCCTTATTTTAAGGATTAAATATAGAATTGCAAAAGTAGTACTTAAACCAA
GCTAAAATCTCTCAGTAAAATTAAGATAAACCTAAAATAGTTGATCCTCAATAGATTTCA
TAGATATTTTAATAGTAAAAAATGGTAAAAGAGCAAAAGTTCATGGACATTTTCAACTAG
TAAAAAGAATATATTTTAAAAAGATAGCATGAAGAGTTGATAAAAAAAGAAATACTAGAA
TAGAAAAAAAATCAACTACTTCAATAGCTAAATTATTTAAATAAATAAAAGCAGGTCAGT
TAAGAAAAAAAAAGGTAAAATCAAAGAAACACTCTCAGTATGTGTAGCTTTTAAAATAGT
GAAACTGATAATAATGAAAACCATGAATAACTAAGTTTTGTTAGTCAACATTATAATTAT
GATCAATTTCATCAAAGTGAAGATGAAGATTATGATCTTCCATAATTTGGATAAAAAAAA
TCTATTAATCAACTTAATAAATTTCCAAAGAGAAGTAAATTAACTATCTAGCCTAAATAA
TAATTCAATAACTCTATGCACATCAGATCTAAATCTATTGGAAGCGTTTTTTAAATAATC
AATACTAAAAATGAATCTGAGTCATATAAATATTGTGAAAGATTATTTTGA


>TTHERM_00353440(gene)
ATGAAAATAAATTTTAATTTAATATTTATTTATTCATTTTTATATTCATATTCCAAATTA
TATATAGCCTGTATATTTATTATAAAAACTTCTTTCTTTCTTACTCCAATCTTTTAAATT
ACAGGCACACTTTTAATTAATTTCAAACTATTTAAATAAATTTTAATTACAATAAAAAAT
TCCTTGATTGAAATGGAAAAAAATTAGAATGACCTTTAGGCAATTTATAACTTAGTATCT
AAAAGATACCTGTAGCTCAAGAGAGAAAGTAAAAGCATAAAGTAAGAATATCAGAGTCCT
TTAAATAACTCTGATGAAGATTCAATAAACACCAGGAGTTGCTTAAAGCATAAAATTGAT
TCAAAGAACAAATCATACTTCAGTAGTAAGAAACAATTAGTCTCACAGTAAGAATTCAAA
AACTACTAAGATGAATATAAAAAAGCTTTTATTGGAAGAGAAAAGGCATTTTACATCAAA
TATAAAAATGATTTAAATGCAATTAAATTTTTAAAACACTGCCTATTTAGCCAAATAAAC
TAGTTAGATTTCAGCTAGTGTGTGTAGGGAAATAACTTATGCCTACAAAAAAAGGATTTA
AGAACTAGAATGAAAGAAGTTTATTCATATATAAATCAAAAACAAATTATGGTGTTTCTT
ATTTTAGGACTAGTTATGTTTGGATACAATTTATGGAACTAGTATCAAGAAATCATAATA
GAAAAGAAGACTTTGGATGAGTTTAGGTTAAGGTATGAAAACGAAAGTGAAGCTTTGTAT
TAGATTTTAAAACAAAAACATGCTCTCTATGAAAAAATAAAAAGGCACAAAGATTTTGGG
ATAATTTAATCATTGCTAAATAGATAAATCAAGCTAAAATTTTCTTTTATTTTTGGAGTA
CTTTCTTTACTGCTGAGTCTATTCAAAGCACTATTTTACCACTTTTCTCATAATAAAATA
AGACCTATGCCCTTATTTTAAGGATTAAATATAGAATTGCAAAAGTAGTACTTAAACCAA
GCTAAAATCTCTCAGTAAAATTAAGATAAACCTAAAATAGTTGATCCTCAATAGATTTCA
TAGATATTTTAATAGTAAAAAATGGTAAAAGAGCAAAAGTTCATGGACATTTTCAACTAG
TAAAAAGAATATATTTTAAAAAGATAGCATGAAGAGTTGATAAAAAAAGAAATACTAGAA
TAGAAAAAAAATCAACTACTTCAATAGCTAAATTATTTAAATAAATAAAAGCAGGTCAGT
TAAGAAAAAAAAAGGTAAAATCAAAGAAACACTCTCAGTATGTGTAGCTTTTAAAATAGT
GAAACTGATAATAATGAAAACCATGAATAACTAAGTTTTGTTAGTCAACATTATAATTAT
GATCAATTTCATCAAAGTGAAGATGAAGATTATGATCTTCCATAATTTGGATAAAAAAAA
TCTATTAATCAACTTAATAAATTTCCAAAGAGAAGTAAATTAACTATCTAGCCTAAATAA
TAATTCAATAACTCTATGCACATCAGATCTAAATCTATTGGAAGCGTTTTTTAAATAATC
AATACTAAAAATGAATCTGAGTCATATAAATATTGTGAAAGATTATTTTGA


>TTHERM_00353440(protein)
MKINFNLIFIYSFLYSYSKLYIACIFIIKTSFFLTPIFQITGTLLINFKLFKQILITIKN
SLIEMEKNQNDLQAIYNLVSKRYLQLKRESKSIKQEYQSPLNNSDEDSINTRSCLKHKID
SKNKSYFSSKKQLVSQQEFKNYQDEYKKAFIGREKAFYIKYKNDLNAIKFLKHCLFSQIN
QLDFSQCVQGNNLCLQKKDLRTRMKEVYSYINQKQIMVFLILGLVMFGYNLWNQYQEIII
EKKTLDEFRLRYENESEALYQILKQKHALYEKIKRHKDFGIIQSLLNRQIKLKFSFIFGV
LSLLLSLFKALFYHFSHNKIRPMPLFQGLNIELQKQYLNQAKISQQNQDKPKIVDPQQIS
QIFQQQKMVKEQKFMDIFNQQKEYILKRQHEELIKKEILEQKKNQLLQQLNYLNKQKQVS
QEKKRQNQRNTLSMCSFQNSETDNNENHEQLSFVSQHYNYDQFHQSEDEDYDLPQFGQKK
SINQLNKFPKRSKLTIQPKQQFNNSMHIRSKSIGSVFQIINTKNESESYKYCERLF