Identifiers and Description

Gene Model Identifier

TTHERM_00355460

Standard Name

MED31 (Mediator subunit 31)

Aliases

PreTt27532 | 37.m00249 | 3836.m02338 | SOH1

Description

MED31 mediator of RNA polymerase II transcription subunit putative; Putative Subunit of the RNA polymerase II mediator complex; conserved with other metazoan MED31 subunits

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02286.1 6.002203762674495e-72
Description: hypothetical protein (151 aa)
DictyBase DDB_G0285221 0.000000000000001999258566166494
Description: med31 on chromosome: 4 position 2996613 to 2997218
WormBase WBGene00007026 0.00000000000004998767099442072
Description: locus:mdt-31 status:Confirmed UniProt:I2HAC1 protein_id:CCH63828.1
SGD YGL127C 0.00000019998969434520019
Description: SOH1 Subunit of the RNA polymerase II mediator complex; associates with core polymerase subunits to form the RNA polymerase II holoenzyme; involved in telomere maintenance; conserved with other metazoan MED31 subunits

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:33786459: Nabeel-Shah S, Garg J, Kougnassoukou Tchara PE, Pearlman RE, Lambert JP, Fillingham J (2021) Functional proteomics protocol for the identification of interaction partners in Tetrahymena thermophila. STAR protocols 2(1):100362
  2. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6
  3. Ref:18515835: Bourbon HM (2008) Comparative genomics supports a deep evolutionary origin for the large, four-module transcriptional mediator complex. Nucleic acids research 36(12):3993-4008

Sequences

>TTHERM_00355460(coding)
ATGATGTAGCATTAAATGAGCATGCAAATTCAAAGCTAAAATCAATAAGATTAAAGCTAA
CAAGCCAACCAAGATCTTATGAATTTTAGGTCTGATTTTGAATAATACTAAAGATTTTAG
TTAGATCTTGAATTTGTCAATATGCTAGCCAATCCATATTACATTTTATAACTTTAAGAA
TATGATTATTTTTCAAACGAAAGATTTTAAAATTATTTGAAGTATTTATCATATTTCAAA
CAACCTGAATATTTCAAATTCGTTAAGTATCCACTAGGCATAAAAATGCTTGATTTAATT
TAACAAGACAAATTTATTGAAAACTTGAGTAATAACGGAATTGAATTAGCAAATAAAATG
AATATTCAAAATACTTATACTAAATAATTTTTAAATTATTTAGCAAAAAAATCTAGCTTG
TAAAAAGATATTAAAAAAGAAGAAAATTGA


>TTHERM_00355460(gene)
ATGATGTAGCATTAAATGAGCATGCAAATTCAAAGCTAAAATCAATAAGATTAAAGCTAA
CAAGCCAACCAAGATCTTATGAATTTTAGGTCTGATTTTGAATAATACTAAAGATTTTAG
TTAGATCTTGAATTTGTCAATATGCTAGCCAATCCATATTACATTTTATGTATAATTAAA
TATTACATTTTAGACAAATAAAATATTTAGATTTTTTTAAATAGAACTTTAAGAATATGA
TTATTTTTCAAACGAAAGATTTTAAAATTATTTGAAGTATTTATCATATTTCAAACAACC
TGAATATTTCAAATTCGTTAAGTAAGCTTTACTATTTAATACAAATCATTTCTAAGCAAT
TTTTTAAAAAAAGGTATCCACTAGGCATAAAAATGCTTGATTTAATTTAACAAGACAAAT
TTATTGAAAACTTGAGTAATAACGGAATTGAATTAGCAAATAAAATGAATATTCAAAATA
CTTATACTAAATAATTTTTAAATTATTTAGCAAAAAAATCTAGCTTGTAAAAAGATATTA
AAAAAGAAGAAAATTGA


>TTHERM_00355460(protein)
MMQHQMSMQIQSQNQQDQSQQANQDLMNFRSDFEQYQRFQLDLEFVNMLANPYYILQLQE
YDYFSNERFQNYLKYLSYFKQPEYFKFVKYPLGIKMLDLIQQDKFIENLSNNGIELANKM
NIQNTYTKQFLNYLAKKSSLQKDIKKEEN