Identifiers and Description

Gene Model Identifier

TTHERM_00355780

Standard Name

MEC17 (homolog of a C. elegans MEChanosensory protein)

Aliases

PreTt27564 | 37.m00281 | 3836.m02370

Description

MEC17 alpha-tubulin N-acetyltransferase; alpha-tubulin acetyltransferase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF05301 ) Protein of unknown function (DUF738)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_02254.1 9.997093137033517e-262
Description: alpha-tubulin N-acetyltransferase (401 aa)
Oxytricha Contig16083.0.g101 8.996537154595168e-51
Description: Touch receptor neuron protein Mec-17
WormBase WBGene00003178 3.99801309251602e-27
Description: locus:mec-17 status:Confirmed UniProt:O45100 protein_id:CCD69773.1
Stentor Coeruleus SteCoe_14200 2.6102790696677047e-23
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00355780(coding)
ATGGAGTTTAATTTCATCATTAATAAGTTAGTTTAATTGGACTAGTAAGGCCTTGGTGTA
TATATACCAAGGGCTAGTAGAAGCAAAGTTAGCAGTTAGCAAGAATAGTAGTTAGGATAA
GTTTTAAATACGATGGGTGAAAGATCAGCGATAGCCTAGGGATTAAAGCAAGTAATAACA
AATTACGATAAGGTATAAGGAACAGACTAAAGAGTTTACATAGTGGCAGAAGGTAGAACT
TGCTAGGGATTTCTTAAAGTTGGATAAAAGAATCTTTTTTATCGAGATATGATGGGAAAT
ATTAAAGAAATTAAGCCACTATGTGTGCTTGACTTTTATGTACATGAATCTTGCCAGAGA
TAAGGATATGGAAAACTACTTTTTGAGTACATGATTTAATGCGAATAAACCTCACCAGAA
AAATTAGCATATGATCGTCCTTCTCCCAAGCTGATAGCCTTCCTTAAAAAGCATTATAAT
TTAGTCAAATACATAGCACAAAATAACAATTTTGTTGTTTTTGATTAGTACTTTAGAAGT
GATGCTTCTAGTTAAAACAAATAAAATTAAAATACTCGTTCTTATTCTTAGCCTTACAGT
GATTATTCTTCGCAAATTCCTACTAATTATCCTTAACAGCAGCAATAACAGTCTAATAGT
AAATCTTATCCTTATAAACAAGAAAATAATATCGATTTAATGCAACACTCTTCATCTAGA
AACAACAAAGAATTCTTGAATGCAGGCAGAGCTATACTATCAAAAGAAGAAATTTATAAA
AAAGATAACTTAAGTCAGTAGAATATAGAAAATACCTTAAATAATATTAATAATTCCTAA
TATTCAACAAAAAGCCAACAATAGCAGTAATATTAAAAAGACTACTAGTTAGATAAGTAT
GAGAATAATTGGGGAGCTGACAAAAATATCAAAAAGCCTCCCTTCCCTGGATAAGATAGA
TAACTTGATAAAATATAGTAAAAAATATAGTAAACTGAAAGAGAGCTTGATGTCGTTAAT
TAACAAATTATTAAGCAAAGGCAAAACCTCTCTCAAGACCCATTAACATAAAACCATAGA
GCATAAAATGTTTATAACACAAATTAGTTTGGAACTTCTCCATGGGCTCAGACAGGATTT
AATTATTATTCAACATCATCTTCTAACTATGGAAATCACTACACATACTACAAAAAATGA


>TTHERM_00355780(gene)
ATGGAGTTTAATTTCATCATTAATAAGTTAGTTTAATTGGACTAGTAAGGCCTTGGTGTA
TATATACCAAGGGCTAGTAGAAGCAAAGTTAGCAGTTAGCAAGAATAGTAGTTAGGATAA
GTTTTAAATACGATGGGTGAAAGATCAGCGATAGTAAGTATTAAGTCAAATACGACAAAT
AAAGATAGAAATTTTACAATTAATAATAGGCCTAGGGATTAAAGCAAGTAATAACAAATT
ACGATAAGGTATAAGGAACAGACTAAAGAGTTTACATAGTGGCAGAAGGTAGAACTTGCT
AGGGATTTCTTAAAGTTGGATAAAAGAATCTTTTTTATCGAGATATGATGGGAAATATTA
AAGAAATTAAGCCACTATGTGTGCTTGACTTTTATGTACATGAATCTTGCCAGAGATAAG
GATATGGAAAAGTATTTTATTTTTATTTTATACAAAAAGCAGAGAAATTCATTAATTTAA
ATTAAATTTTAATATGAATGTAGCTACTTTTTGAGTACATGATTTAATGCGAATAAACCT
CACCAGAAAAATTAGCATATGATCGTCCTTCTCCCAAGCTGATAGCCTTCCTTAAAAAGC
ATTATAATTTAGTCAAATACATAGCACAAAATAACAATTTTGTTGTTTTTGATTAGTACT
TTAGAAGTGATGCTTCTAGTTAAAACAAATAAAATTAAAATACTCGTTCTTATTCTTAGC
CTTACAGTGATTATTCTTCGCAAATTCCTACTAATTATCCTTAACAGCAGCAATAACAGT
CTAATAGTAAATCTTATCCTTATAAACAAGAAAATAATATCGATTTAATGCAACACTCTT
CATCTAGAAACAACGTAAAAAATATTTATAAAATAGATGAACAATTTTATATTTATTTTC
AAGCACTACTTATTAAACATGATTAATTTTTATAAAAATACTATTTAATTTAAATAGAAA
GAATTCTTGAATGCAGGCAGAGCTATACTATCAAAAGAAGAAATTTATAAAAAAGATAAC
TTAAGTCAGTAGAATATAGAAAATACCTTAAATAATATTAATAATTCCTAATATTCAACA
AAAAGCCAACAATAGCAGTAATATTAAAAAGACTACTAGTTAGATAAGTATGAGAATAAT
TGGGGAGCTGACAAAAATATCAAAAAGCCTCCCTTCCCTGGATAAGATAGATAACTTGAT
AAAATATAGTAAAATTAATTTATTAGTTTCAATAATTAAAACAAATATTTAGGTAAAAAA
TATAGTAAACTGAAAGAGAGCTTGATGTCGTTAATTAACAAATTATTAAGTAAAAAGTTT
AATTATTTTTTGTTATTCAAAAATTATAATTACATTATTTAATAGGCAAAGGCAAAACCT
CTCTCAAGACCCATTAACATAAAACCATAGAGCATAAAATGTTTATAACACAAATTAGTT
TGGAACTTCTCCATGGGCTCAGACAGGATTTAATGTAAGAAATTAAAATAAAAATAAAAA
TATTAAATTATTTTTAATAAAAAATAAATAGTATTATTCAACATCATCTTCTAACTATGG
AAATCACTACACATACTACAAAAAATGA


>TTHERM_00355780(protein)
MEFNFIINKLVQLDQQGLGVYIPRASRSKVSSQQEQQLGQVLNTMGERSAIAQGLKQVIT
NYDKVQGTDQRVYIVAEGRTCQGFLKVGQKNLFYRDMMGNIKEIKPLCVLDFYVHESCQR
QGYGKLLFEYMIQCEQTSPEKLAYDRPSPKLIAFLKKHYNLVKYIAQNNNFVVFDQYFRS
DASSQNKQNQNTRSYSQPYSDYSSQIPTNYPQQQQQQSNSKSYPYKQENNIDLMQHSSSR
NNKEFLNAGRAILSKEEIYKKDNLSQQNIENTLNNINNSQYSTKSQQQQQYQKDYQLDKY
ENNWGADKNIKKPPFPGQDRQLDKIQQKIQQTERELDVVNQQIIKQRQNLSQDPLTQNHR
AQNVYNTNQFGTSPWAQTGFNYYSTSSSNYGNHYTYYKK