Identifiers and Description

Gene Model Identifier

TTHERM_00361720

Standard Name

RCL1 (RNA terminal phosphate cyclase RCL1)

Aliases

PreTt13387 | 38.m00222

Description

RCL1 RNA 3-prime-terminal phosphate cyclase; RNA 3'-terminal phosphate cyclase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF01137 ) RNA 3'-terminal phosphate cyclase
  • ( TIGR03399 ) RNA 3'-phosphate cyclase
  • ( TIGR03400 ) 18S rRNA biogenesis protein RCL1

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_01321.1 1.0002211124116698e-173
Description: RNA 3-terminal phosphate cyclase (374 aa)
DictyBase DDB_G0276159 3.9990760533890984e-36
Description: rtc1 on chromosome: 2 position 6274208 to 6275509
Stentor Coeruleus SteCoe_38408 0.000000000000004658886145103398
Description: None
Oxytricha Contig3020.0.g29 0.0000000010002658722841845
Description: RNA 3-terminal phosphate cyclase
SGD YOL010W 0.000000009996807949091551
Description: RCL1 Subunit of U3-containing 90S preribosome processome complex involved in 18S rRNA biogenesis and small ribosomal subunit assembly; stimulates Bms1p GTPase and U3 binding activity; similar to RNA cyclase-like proteins but no activity detected

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00361720(coding)
ATGGTAGACGTAGTATATCTTTAAATAGATGGTTCTCTTCATGAAGGAGGAGGTTAGATA
ATCAGATCAAGCATGGCTCTTAGCAATATCTTATAAAAGCCTATTCAATTAAAAAATATA
AGAGTTAACCGACCAAATCCTGGATTGAATAATTAGCTTATGGGAGCTATTAAATTGATG
AGAGAAATCTCTAAAGCATAGGTAGTAGGTGATAAATAAAAATCATTGAAGATCACTTAT
GAACCTTAGATGAAAATTAAAAGCGGAAATTATGCAGGAGGATCTTAGAGTGCAGCTGCC
ATAAGTCTCATGGTTTAATCTTTAATTCCTACTATGATTTTTGGAAAAGCCTAGTCAACT
ATTAAACTTTAGGGTGGTAGTGATGTAAACAAATCTCCTCCATTTGAAACAATACAAAGA
ATTCTAAAGCCACTTTTAGAAAAAATGGGAATTCATTTTAATTACAATTTAATCACAGAA
GGTTACTACCCAAGAGGTGGTGGATAGATTTAATTAGAAGTATAGCCAATTGCTGATTAC
ATAAAGCCTATTACTATAACAAAACGCACTGTTATAAATAAAATTTATTTGCAATTTATT
TTGACTGAAACATGTGAAAAAGCTTAAAAAGATTATTTTAGACCTTTGAAAAAAGACATA
ATAAGCTTCTTAGTAAGTAAATAGCCTGGAATTAAAGAGGAAGATATTGAATTTGAAGTA
GATGTAAAGCAAATAAAAAACAAAAAATATAAAGAATGTTACTCTATTGTTGCTCATGCA
TATGGATCTGAAGATAATTATTTTGCTTTTTCTTTTTACAATGATGATGATCTAAAAGTC
GAAGTAATTATTTTATTAATACTAATAATATTAAATGATGTTTTTACTAGGATGCATCAC
AAAAAGTTTATGAAAACTTTGTTAAAGAACTTTCAGAAGGAGGCTGTTTAGATGAATACC
ATTAAGACTAATTATTATTGTACATGGCATTAGCTAATGGAGAGTCTCAAATTAGAGTAA
ACCCAGCTATCACAGATCACTCTTTAGCTTGCTTTTACGTACTTAAAGAATTTATCCCAG
AAGTAAAAATTGATGTAATTGATGAAGAAGTAGCTGGTCTTAGATCTAAAATTATCAAAA
TTGTAGGAGTAGGTTTTAAAAACGAATGAACAAGTTTTAAATTAAACTTGCTAAAATAAA
TTAATAAAAATATTTATTTATTTATAAAAAAAAATTAACATAAATAAAGATATATTTATA
ATAATTTTGGTTTTTATATTCAATAAACTTTAAATTGTATAATAAAACAAACAAATTGAA
TGCTACATGTAAAATAAATTAATTAATAATAAACCTCTATACTTATATAATATATAGCCT
CTTAGCATATAATTTCCATAAGAGGATTTATTTATATTTTTAATTGAGCTAGAAAGGGTT
TTTTTGGTTATATTTTTTTTAAAAAAACTCAAATAAATTTTTTAGAAATAACTCACTTAT
TTAAAAAATTAGATTTGA


>TTHERM_00361720(gene)
ATGGTAGACGTAGTATATCTTTAAATAGATGGTTCTCTTCATGAAGGAGGAGGTTAGGTA
TATAAGTTATTAGTACATTTTATTTGGTATTGAATCATTATCGTGAAATTTAATTAGATA
ATCAGATCAAGCATGGCTCTTAGCAATATCTTATAAAAGCCTATTCAATTAAAAAATATA
AGAGTTAACCGACCAAATCCTGGATTGAATAATTAGCTTATGGGAGCTGTAAAAGATAAT
TACAAAATCATTTGAATATTACAATAAATTATATTTTTAGATTAAATTGATGAGAGAAAT
CTCTAAAGCATAGGTAGTAGGTGATAAATAAAAATCATTGAAGATCACTTATGAACCTTA
GATGAAAATTAAAAGCGGTATATAAAATAATCAAAAATTAGGTTGAAATAACTAAATAGT
TAGTGTTTTATATACAGGAAATTATGCAGGAGGATCTTAGAGTGCAGCTGCCATAAGTCT
CATGGTTTAATCTTTAATTCCTACTATGATTTTTGGAAAAGCCTAGTCAACTATTAAACT
TTAGGTAGAATATTAAAATTTATATATCAAATAAAGATATGCTTGCATTCCTCTACTAAT
TTAATAGACTCTTTTAAAACTAACAAATTAGTAAACAAAAAAGAGATAAAATCTTAATTT
AATTTAAATTAATTAATAATATTTGCAAAAAAAATAGACATTTAACAATATTATAATTAC
ACTTTTACAATTTCTAAATAATGTTTTTATTTATAAAAATTATTTTAGGGTGGTAGTGAT
GTAAACAAATCTCCTCCATTTGAAACAATACAAAGAATTCTAAAGCCACTTTTAGAAAAA
ATGGGAATTCATTTTAATTACAATTTAATCACAGAAGGTTACTACCCAAGAGGTGGTGGA
TAGATTTAATTAGAAGTATAGCCAATTGCTGATTACATAAAGCCTATTACTATAACAAAA
CGCACTGTTATAAATAAAATTTATTTGCAATTTATTTTGACTGAAACATGTGAAAAAGCT
TAAAAAGATTATTTTAGACCTTTGAGTAAGAAAATTAAATTTATTTAATGAATTGAATGT
TAAAGTGGTGTTAAAAAAGCAAACTTAAATTATTAAAAACAGAAAAAGACATAATAAGCT
TCTTAGTAAGTAAATAGCCTGGAATTAAAGAGGAAGATATTGAATTTGAAGTAGATGTAA
AGCAAATAAAAAACAAAAAATATAAAGAATGTTACTCTATTGTTGCTCATGCATATGGAT
CTGAAGATAATTATTTTGCTTTTTCTTTTTACAATGATGATGATCTAAAAGTCGAAGTAA
TTATTTTATTAATACTAATAATATTAAATGATGTTTTTACTAGGATGCATCACAAAAAGT
TTATGAAAACTTTGTTAAAGAACTTTCAGAAGGAGGCTGTTTAGATGAATACCATTAAGA
CTAAGTAATACTTTTATTTATTTATTTATTTATATTTTAACTTTAATTTTTTTTGTTAAA
GTTATTATTGTACATGGCATTAGCTAATGGAGAGTCTCAAATTAGAGTAAACCCAGCTAT
CACAGATCACTCTTTAGCTTGCTTTTACGTACTTAAAGAATTTATCCCAGAAGTAAAAAT
TGATGTAATTGATGAAGAAGTAGCTGGTCTTAGATCTAAAATTATCAAAATTGTAGGAGT
AGGTTTTAAAAACGAATGAACAAGTTTTAAATTAAACTTGCTAAAATAAATTAATAAAAA
TATTTATTTATTTATAAAAAAAAATTAACATAAATAAAGATATATTTATAATAATTTTGG
TTTTTATATTCAATAAACTTTAAATTGTATAATAAAACAAACAAATTGAATGCTACATGT
AAAATAAATTAATTAATAATAAACCTCTATACTTATATAATATATAGCCTCTTAGCATAT
AATTTCCATAAGAGGATTTATTTATATTTTTAATTGAGCTAGAAAGGGTTTTTTTGGTTA
TATTTTTTTTAAAAAAACTCAAATAAATTTTTTAGAAATAACTCACTTATTTAAAAAATT
AGATTTGA


>TTHERM_00361720(protein)
MVDVVYLQIDGSLHEGGGQIIRSSMALSNILQKPIQLKNIRVNRPNPGLNNQLMGAIKLM
REISKAQVVGDKQKSLKITYEPQMKIKSGNYAGGSQSAAAISLMVQSLIPTMIFGKAQST
IKLQGGSDVNKSPPFETIQRILKPLLEKMGIHFNYNLITEGYYPRGGGQIQLEVQPIADY
IKPITITKRTVINKIYLQFILTETCEKAQKDYFRPLKKDIISFLVSKQPGIKEEDIEFEV
DVKQIKNKKYKECYSIVAHAYGSEDNYFAFSFYNDDDLKVEVIILLILIILNDVFTRMHH
KKFMKTLLKNFQKEAVQMNTIKTNYYCTWHQLMESLKLEQTQLSQITLQLAFTYLKNLSQ
KQKLMQLMKKQLVLDLKLSKLQEQVLKTNEQVLNQTCQNKLIKIFIYLQKKININKDIFI
IILVFIFNKLQIVQQNKQIECYMQNKLINNKPLYLYNIQPLSIQFPQEDLFIFLIELERV
FLVIFFLKKLKQIFQKQLTYLKNQI