Identifiers and Description

Gene Model Identifier

TTHERM_00370900

Standard Name

IRS1 (Isoleucyl-tRNA synthetase 1)

Aliases

PreTt28606 | 39.m00179 | 3693.m00026

Description

IRS1 isoleucyl-tRNA synthetase protein; Isoleucyl-tRNA synthetase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197
  • positive regulation of catabolic process (IEA) | GO:0009896

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12245.1 9.997093137033517e-262
Description: isoleucyl-tRNA synthetase (1178 aa)
DictyBase DDB_G0293030 4.001287313050914e-66
Description: mileS on chromosome: 6 position 2348091 to 2351327
Oxytricha Contig11813.0.g68 1.0003503620230312e-57
Description: tRNA synthetases class I (I, L, M and V)
SGD YPL040C 1.9998323414791308e-36
Description: ISM1 Mitochondrial isoleucyl-tRNA synthetase, null mutant is deficient in respiratory growth
WormBase WBGene00002153 5.999781043483669e-32
Description: locus:iars-2 status:Confirmed UniProt:E2JL04 protein_id:CBX25138.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00370900(coding)
ATGATTAGGTTTTGCCTTAGAACTGGCATTTAGCAGTATTTGTATAATTAGAATTAGTTA
TTTAGGTTTGCAAGAAAACAAACTCCCCAACAGTAAAAGAGAAAGAATCTAATTGCTGAT
GATGTTGAATAAGATGGAAAAAATGATTAAGTTTTTAGTGAAAGTGATAACGAAGAAATA
GAATACCAAGAATAAAGAGGAAATAATCAAACTTATAAATCTAAGAATAATGAATTAGTT
ATTCAGAAAAATGATCTGATGCTTCATATTCCAAAAACTGAATTTAATCCTCGTTTCAAG
CCAACTCTTAATGAAGAAAGATATCATAATAAAATAGCTCAAAATTTATACTTATGGTAA
TAAGCTAACAAAAATAATCCTGAAAAACAGTATGTTATTCATGATTTACCATTCTTAACT
TATGGCGAACCTCATTTAGGACATTTCTACAATAAAACTCAGTAAGATATTGCAGCAAGA
TTTGCAATGCTAAACGGATATAAAGTAACTCATCAAATAGGCTTTAATCTCCATGGTTAA
ACTATATAAAACTAAGCAGTTATTGCAGAGTAGCTGAAAACTAAAGAATTAAAGAGATTC
AGCTCCTAAGAAATCAGAGATATATCAAACAATTTTGCCTATGAGAGCTTAAAAAATATT
ATCATAAAAATGTCTCGTTGGGGTTTAATGACTGATTTTTCTCAAGCTTATACTACTAAC
CATCCTTTTTACGAAAGTGGTGTACTCAAAGCATTTTACGAGCTAGTTTAAGAAAAAAGC
ATTTTCTTAGATGAAAAGCCAACTTTGTGGTCAGTCAAAAACAGAACTGCCTTAGACGAT
GATGAAGCTAACATGGAAATTATTCCTAAACCCGGAACATTTATTAAATTTGAAGTGAAA
AACTTTGGAAACAATATTTTCCTGTAAAATTTAGCTTAAGAACATCAAGTTAAAGTTTAT
GTTATTGGTTTCACTACTGAATTGTGGACCTTAAATTCTTTAAGAGCGCTTTCAGTCAAT
GAAAATGTTTAATATGGTATATATAAATCAGGAGATGCACTTTATGTTATTTCTAGAAAC
AGATTTAAGCATCACCGTCTTTTTTTTAAGGAAGAAAATAAGGGAACACTTGTTTCTACA
TAAACAGGAAAATAAATATCATAACTTACAGTATTTGATCAAGCTTTTGAAAGGGATATT
CCAGTTTTAAGCTGTGATACTTATGCTAAAAATGAAAGATTTGGATTAGGTATTGCTTGT
GTATGCCCTGGTCATTATTCTAAAGACTTTTAAGTTTCTGAGTAGTATGATTTGAGCAAA
AAAGCGCATGTTAATAAATTTGGTAGATTAGATTAAACAGTTCCTAATGATTTATAAAAT
CTTAGTGTAGTTAATGGTGAAGCAGATGAGCATATACTATAAAAATACTTAGATCAGAAT
TTGGTTCTAGACATTGATGAAAACTATGAAACAGAGTAGTATTTTGATAAAAAAACTAAT
GAAAAATTAATAGTAAGAACTTAAATGACTGTTTACTCGAGGTTACCAGATTTTGAAAGA
GAATATTTTGTTGAGCAACTTAAAGAGAAAATTAAAATTAAGATTAGCGGATAGCTATCA
AATAAAGAAAGTTAATCAGAAAGCTAAGAGGGTGCTTTTGGTTCTCTAGAAAAATAAATC
TTAGAAAAGTCTGACAACTGGACTATTTCTTCAAATCAAGAATGGGGCATTCCAATTCCT
ATCTTCTTTTACATAAATACCAATCAGTAAAAGTATCTATTAGAACCTGCAGTTGTGAAA
CATATTATTGGGCTCTATGAATAATTTGGAAGCTAAATTTGGCATCAATATTCAATAGAA
GAGCTTTTACCATAGAAATATAAGAATTTAGCAGCTCAATTAGAGAAAGGGTAATTTACA
TTTGATTAATGGTTTGAAAGTGGATGCAGTTGGTATGTAATGCTTAAAAGTAAACCTAAT
GGTTAAGATATTAGACAAAAGTTTTTGATTTAATAAAATGATTTAATTAAATAAAAGCAG
AAATAATTATCTATTGAGAATAAAGATTAAGATTAATCAAAATAAATTGTTTCTTCATCA
AGCTAATCAAGTTAAGCAAGCTCTGGAGAATTTAACATAGTTCAAAAATATCCATGTGAC
TTAGCTATTTAGGGTAAAGATCAAATTGATAGTTGGTTATTGTCAACTTCTTTACTGTCA
ATTGGATTAAAAGAGCATGCCTTTTTTAATAATTTGAAGCTTCATAGAGTTATCCCTGCA
ACTAATGATGAAAAATTATCTAAATTATCATAATTTAAGAGCAGTATAGATGATTATATT
GAAGGAACAGTTAAATTAAATGGGGAAAGATAGTACGGATACGGAGTTGATATCCTTAGA
ATGTGGGTTGCTCTTTCAGATAAAGTTAGAGAATAAGTTAATGATAAAAAAAAGAAAAAA
GAAAAAAATGAAAATGCTATTTAAGTAGCTGAAAATATGGACTACATATTTATGAGACCA
AACGAATTCGATGTACCAAATAATTATATTAACATTTTCAGAAAATGTATGTGGAATATG
TTAGGTAGTTTGAAAGGATATAATTAAAATCTTGAATAAATAAAAATATTCAATAATGGA
AAACTTTCATTCTTAAGCGATTACATGATGACATAATTAGTTCTTTATATGATAAACATG
CATAGAGCTTATTAGCAACTCGATTACGCTACTAATGTAGATTTAACTATGGACTTCATT
AAAAATTGGGTTTATGATTTCTTCTTGGATTCTACTAAAAACTTTATAATTTCTAATCCA
GTTGATCCTAAAACTTAAGAATATCTTTTTGTTTACTCTAAGATAGTAGAAAACCTTTTA
ATAGCAGTTTCCCCTATGATCCCTCATAACGCAGAAGATATTTTTAGTAATGTGCACTTT
AAATTAAATAAAAAAGAATCAATTTTCCATTACGATTGGCCTGATATGAGTAAAGAAGAT
GTCCATTCATTGTAGAGCAAAATCCCAAAATAAAATTTGCTCTGGTAATTAAGAGAGTGT
ATTTGGGAATAATTGACATTTTAAATGGAAAGATATCAAAACATTCGTTCAAAAGAAAGA
TATGATATAGTGATTATAGTTGATGAATTATTTAGTAAAGAGTACTCTATTTTAGAAGAA
ACATGTATAGATGAATTAGATTCCTTTATTGGAGCAGGTTAAGTAAAAGTGCATACTTTG
AAAGAAAATTAGGAATATCCTCACAACTCTATTAGTACATTTAAATTTAAAACAAATTAT
CTAAGTAATGAAAAGCTAAGCTACACTATAAAAATATATTTATCTGAAAACTTTAAGTGT
ATCAGATGCCATAAATATACAGCTATATATGAAAATACTATATGTCCTCACTGCATTACT
TATTTATCTACCAACCATAAGAAGTAATGCAATCATCTACTTAATTAAATAAAAAGAAAT
CCATAATTACCTATTAAAGTTATAGATCCTAAACAAAAAATTCTAGAATGA


>TTHERM_00370900(gene)
ATGATTAGGTTTTGCCTTAGAACTGGCATTTAGCAGTATTTGTATAATTAGAATTAGTTA
TTTAGGTTTGCAAGAAAACAAACTCCCCAACAGTAAAAGAGAAAGAATCTAATTGCTGAT
GATGTTGAATAAGATGGAAAAAATGATTAAGTTTTTAGTGAAAGTGATAACGAAGAAATA
GAATACCAAGAATAAAGAGGAAATAATCAAACTTATAAATCTAAGAATAATGAATTAGTT
ATTCAGAAAAATGATCTGATGCTTCATATTCCAAAAACTGAATTTAATCCTCGTTTCAAG
CCAACTCTTAATGAAGAAAGATATCATAATAAAATAGCTCAAAATTTATACTTATGGTAA
TAAGCTAACAAAAATAATCCTGAAAAACAGTATGTTATTCATGATTTACCATTCTTAACT
TATGGCGAACCTCATTTAGGACATTTCTACAATAAAACTCAGTAAGATATTGCAGCAAGA
TTTGCAATGCTAAACGGATATAAAGTAACTCATCAAATAGGCTTTAATCTCCATGGTTAA
ACTATATAAAACTAAGCAGTTATTGCAGAGTAGCTGAAAACTAAAGAATTAAAGAGATTC
AGCTCCTAAGAAATCAGAGATATATCAAACAATTTTGCCTATGAGAGCTTAAAAAATATT
ATCATAAAAATGTCTCGTTGGGGTTTAATGACTGATTTTTCTCAAGCTTATACTACTAAC
CGTAAAAATATATATTCAAATATTTTAAATAAGATTTACAATTTTTCATATATTGTTTTT
ATTCAATATGTTAAAATAGTTTTCAATCAATATTATTACAAAATAAATATTTTAATTATT
ATTCAAATTTTATTTATTTTTTTAGATCCTTTTTACGAAAGTGGTGTACTCAAAGCATTT
TACGAGCTAGTTTAAGAAAGTAAAACTTTTTCAAGGTTGAAATTATATTTAGTGAGTTTT
AATATTATCAGAAAGCATTTTCTTAGATGAAAAGCCAACTTTGTGGTCAGTCAAAAACAG
AACTGCCTTAGACGATGATGAAGCTAACATGGAAATTATTCCTAAACCCGGAACATTTAT
TAAATTTGAAGTGAAAAACTTTGGAAACAATATTTTCCTGTAAAATTTAGCTTAAGAACA
TCAAGTTAAAGTTTATGTTATTGGTTTCACTACTGAATTGTGGACCTTAAATTCTTTAAG
AGCGCTTTCAGTCAATGAAAATGTTTAATATGGTATATATAAATCAGGAGATGCACTTTA
TGTTATTTCTAGAAACAGATTTAAGCATCACCGTCTTTTTTTTAAGGAAGAAAATAAGGG
AACACTTGTTTCTACATAAACAGGAAAATAAATATCATAACTTACAGTAATTTTAGTTTA
TTTAGATTATAAAAATATATTCATTCATTCATTCATTCATTCATTTTTTAAGGTATTTGA
TCAAGCTTTTGAAAGGGATATTCCAGTTTTAAGCTGTGATACTTATGCTAAAAATGAAAG
ATTTGGATTAGGTATTGCTTGTGTATGCCCTGGTCATTATTCTAAAGACTTTTAAGTTTC
TGAGTAGTATGATTTGAGCAAAAAAGCGCATGTTAATAAATTTGGTAGATTAGATTAAAC
AGTTCCTAATGATTTATAAAATCTTAGTGTAGTTAATGGTGAAGCAGATGAGCATATACT
ATAAAAGTAAAAAGATTTATATTCTCTTTATTTTATTCAAATAGACTTTATTAAATTAGA
ATTAATAACTTTCAACAACATTAATAAATAAATGAGAATAAATAAGTTATTTTAAAACTC
TGAAATTTATTTAATAAATTAATTAAATTCATAGATACTTAGATCAGAATTTGGTTCTAG
ACATTGATGAAAACTATGAAACAGAGTAGTATTTTGATAAAAAAACTAATGAAAAATTAA
TAGTAAGAACTTAAATGACTGTTTACTCGAGGTTACCAGATTTTGAAAGAGAATATTTTG
TTGAGCAACTTAAAGAGAAAATTAAAATTAAGATTAGCGGATAGCTATCAAATAAAGAAA
GTTAATCAGAAAGCTAAGAGGGTGCTTTTGGTTCTCTAGAAAAATAAATCTTAGAAAAGT
CTGACAACTGGACTATTTCTTCAAATCAAGAATGGGGCATTCCAATTCCTATCTTCTTTT
ACATAAATACCAATCAGTAAAAGTATCTATTAGAACCTGCAGTTGTGAAACATATTATTG
GGCTCTATGAATAATTTGGAAGCTAAATTTGGCATCAATATTCAATAGAAGAGCTTTTAC
CATAGAAATATAAGTAAAAAACAATTAAATTTTATCAATGATAAATATATTTTTATTAAT
TAAAGGAATTTAGCAGCTCAATTAGAGAAAGGGTAATTTACATTTGATTAATGGTTTGAA
AGTGGATGCAGTTGGTATGTAATGCTTAAAAGTAAACCTAATGGTTAAGATATTAGACAA
AAGTTTTTGATTTAATAAAATGATTTAATTAAATAAAAGCAGAAATAATTATCTATTGAG
AATAAAGATTAAGATTAATCAAAATAAATTGTTTCTTCATCAAGCTAATCAAGTTAAGCA
AGCTCTGGAGAATTTAACATAGTTCAAAAATATCCATGTGACTTAGCTATTTAGGGTAAA
GATCAAATTGATAGTTGGTTATTGTCAACTTCTTTACTGTCAAGTAATATTAAATTTAAA
TATAATTATTTTATAGCTAAATTTTTAAATAGTTGGATTAAAAGAGCATGCCTTTTTTAA
TAATTTGAAGCTTCATAGAGTTATCCCTGCAACTAATGATGAAAAATTATCTAAATTATC
ATAATTTAAGAGCAGTATAGATGATTATATTGAAGGAACAGTTAAATTAAATGGGGAAAG
ATAGTACGGATACGGAGTTGATATCCTTAGAATGTGGGTTGCTCTTTCAGATAAAGTTAG
AGAATAAGTTAATGATAAAAAAAAGAAAAAAGAAAAAAATGAAAATGCTATTTAAGTAGC
TGAAAATATGGACTACATATTTATGAGACCAAACGAATTCGATGTACCAAATAATTATAT
TAACATTTTCAGAAAATGTATGTGGAATATGTTAGGTAGTTTGAAAGGATATAATTAAAA
TCTTGAATAAATAAAAATATTCAATAATGGAAAACTTTCATTCTTAAGCGATTACATGAT
GACATAATTAGTTCTTTATATGATAAACATGCATAGAGCTTATTAGCAACTCGATTACGC
TACTAATGTAGATTTAACTATGGACTTCATTAAAAATTGGGTTTATGATTTCTTCTTGGA
TTCTACTAAAAACTTTATAATTTCTAATCCAGTTGATCCTAAAACTTAAGAATATCTTTT
TGTTTACTCTAAGGTAAATTTTAATTAACTAATCGAAGCTCATTTTGTTTTATATATTCA
AATAGATAGTAGAAAACCTTTTAATAGCAGTTTCCCCTATGATCCCTCATAACGCAGAAG
ATATTTTTAGTAATGTGCACTTTAAATTAAATAAAAAAGAATCAATTTTCCATTACGATT
GGCCTGATATGGTAAATAATTATTTTAAAAATTAATTTATTATTGAATGATATATATTAT
TTAAAGAGTAAAGAAGATGTCCATTCATTGTAGAGCAAAATCCCAAAATAAAATTTGCTC
TGGTAATTAAGAGAGTGTATTTGGGAATAATTGACATTTTAAATGGAAAGATATCAAAAC
ATTCGTTCAAAAGAAAGATATGATATAGTGATTATAGTTGATGAATTATTTAGTAAAGAG
TACTCTATTTTAGAAGAAACATGTATAGATGAATTAGATTCCTTTATTGGAGCAGGTTAA
GTAAAAGTGCATACTTTGAAAGAAAATTAGGAATATCCTCACAACTCTATTAGTACATTT
AAATTTAAAACAAATTATCTAAGTAATGAAAAGCTAAGCTACACTATAAAAATATATTTA
TCTGAAAACTTTAAGTGTATCAGATGCCATAAATATACAGCTATATATGAAAATACTATA
TGTCCTCACTGCATTACTTATTTATCTACCAACCATAAGAAGTAATGCAATCATCTACTT
AATTAAATAAAAAGAAATCCATAATTACCTATTAAAGTTATAGATCCTAAACAAAAAATT
CTAGAATGA


>TTHERM_00370900(protein)
MIRFCLRTGIQQYLYNQNQLFRFARKQTPQQQKRKNLIADDVEQDGKNDQVFSESDNEEI
EYQEQRGNNQTYKSKNNELVIQKNDLMLHIPKTEFNPRFKPTLNEERYHNKIAQNLYLWQ
QANKNNPEKQYVIHDLPFLTYGEPHLGHFYNKTQQDIAARFAMLNGYKVTHQIGFNLHGQ
TIQNQAVIAEQLKTKELKRFSSQEIRDISNNFAYESLKNIIIKMSRWGLMTDFSQAYTTN
HPFYESGVLKAFYELVQEKSIFLDEKPTLWSVKNRTALDDDEANMEIIPKPGTFIKFEVK
NFGNNIFLQNLAQEHQVKVYVIGFTTELWTLNSLRALSVNENVQYGIYKSGDALYVISRN
RFKHHRLFFKEENKGTLVSTQTGKQISQLTVFDQAFERDIPVLSCDTYAKNERFGLGIAC
VCPGHYSKDFQVSEQYDLSKKAHVNKFGRLDQTVPNDLQNLSVVNGEADEHILQKYLDQN
LVLDIDENYETEQYFDKKTNEKLIVRTQMTVYSRLPDFEREYFVEQLKEKIKIKISGQLS
NKESQSESQEGAFGSLEKQILEKSDNWTISSNQEWGIPIPIFFYINTNQQKYLLEPAVVK
HIIGLYEQFGSQIWHQYSIEELLPQKYKNLAAQLEKGQFTFDQWFESGCSWYVMLKSKPN
GQDIRQKFLIQQNDLIKQKQKQLSIENKDQDQSKQIVSSSSQSSQASSGEFNIVQKYPCD
LAIQGKDQIDSWLLSTSLLSIGLKEHAFFNNLKLHRVIPATNDEKLSKLSQFKSSIDDYI
EGTVKLNGERQYGYGVDILRMWVALSDKVREQVNDKKKKKEKNENAIQVAENMDYIFMRP
NEFDVPNNYINIFRKCMWNMLGSLKGYNQNLEQIKIFNNGKLSFLSDYMMTQLVLYMINM
HRAYQQLDYATNVDLTMDFIKNWVYDFFLDSTKNFIISNPVDPKTQEYLFVYSKIVENLL
IAVSPMIPHNAEDIFSNVHFKLNKKESIFHYDWPDMSKEDVHSLQSKIPKQNLLWQLREC
IWEQLTFQMERYQNIRSKERYDIVIIVDELFSKEYSILEETCIDELDSFIGAGQVKVHTL
KENQEYPHNSISTFKFKTNYLSNEKLSYTIKIYLSENFKCIRCHKYTAIYENTICPHCIT
YLSTNHKKQCNHLLNQIKRNPQLPIKVIDPKQKILE