Identifiers and Description

Gene Model Identifier

TTHERM_00371290

Standard Name

DRH17 (DExD/H box RNA helicase 17)

Aliases

PreTt28645 | 39.m00218 | 3693.m00065

Description

DRH17 DEAD/DEAH-box helicase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04851 ) type III restriction enzyme, res
  • ( PF09006 ) Lung surfactant protein D coiled-coil
  • ( TIGR00614 ) ATP-dependent DNA helicase, RecQ family
  • ( TIGR01587 ) CRISPR-associated helicase Cas3

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12273.1 9.997093137033517e-262
Description: DEAD/DEAH box helicase (664 aa)
DictyBase DDB_G0277527 9.997652352281279e-57
Description: ddx20 on chromosome: 2 position 8128317 to 8130866
WormBase WBGene00002083 5.0007856079333316e-54
Description: locus:inf-1 Eukaryotic initiation factor 4A status:Confirmed UniProt:P27639 protein_id:CCD70313.1
SGD YDR021W 1.999385218781115e-51
Description: FAL1 Nucleolar protein required for maturation of 18S rRNA, member of the eIF4A subfamily of DEAD-box ATP-dependent RNA helicases
Oxytricha Contig2122.0.g98 9.996696112986116e-50
Description: DEAD/DEAH box helicase
Stentor Coeruleus SteCoe_16829 1.4251640827409352e-21
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00371290(coding)
ATGAATTAACAAGACAACTTCAACACAGAAATCTCTCATAAATAAATAAAATCTTTTCAC
TAACTTAAATTATCTTCAGGAGACTATTTACGTGCATTAGAGAAGCTACACTTTACCGAG
CCAACTCCAATTTAAATACTTTCAATACCTGAAGGTTTGACAGAAAAGAACATTATTGCA
TAGGCTAAAGCAGGAACAGGAAAAACTTTAGCTTTTAGCAGTATTATACTCGAAAAATTG
ATAAATAGGAGGCAAACAATATTTTAAGATTCAAATCCATTAGTCTTAATTATATTACCT
ACAAGAGAGTTAGCAATTCAGGTATTCGAATTTATTCAGCAACTATTAAAGGCTCTAAAT
ACTATAAATCCTAATTTATTACCTTATGTTAATTGCGGAATCTTTATTGGAGGACTACCA
CTGCAAGATGATAGGAGAAATCTCAAAATACAGCATGTAAAAATAATAATTGGAACAATA
GGAAGAATTGTAGCTCTAATAAAAGAAAATTCATTGGTACTTTCTTCAATAAACACCCTT
GTGCTAGATGAGGCAGATAAACTAATGGGATAAAAAGACTTTTACAAACACATAACTTAT
ATATTTGATGCTTTAAATAAGTAGACTCTAAATAATATATCTATTAGTAGTTAATTAGAT
ATCAACAGTAATATAGAAGAATTAAAGTCATAATAAGAATAAACTCTAATTTAAGATGAA
AAAGAAACTGCTTTTGAAGTTCTTCAAAGGAGGAAAAAAAACTTAAAGTTACCTGTTTAA
TACTTAGCTTATTCGGCAACTTACCCTGATGATCTCAAATAAAAAATTGAGAAATTGATG
GAAACAAGTGTATTTGTAGACGCAATTTAATTATAAAATTAAAGTGATTCACAGAGCACT
GAAAATTAACAGAATGATAATAGAGATTTGAATCTAGAAAATATCATTTAATATAGAGTT
GATGTAAAATAGGAAGGAAATGTTTCAGTAACAAAACAAAAAATAAATATTCTCACAAGT
GTTTTAAAGTAGATTAAGTTTAATCAAGCAATAATATTTTACAATGATAAAATCAAAGGA
GAAAATATTTTTAGTGAACTTAAAGCTTAAAATTATTCTGTTATCTTTATTCATGGAGAT
TAAACTTAGGCAGATAGAATCAAAGTTATGAACTAAATTCGTAGAAATAAAACTTAAATT
ATAATTTCTACTGACTTACTTTCAAGAGGTATTGACATCACTACTATTGATTTAGTTATA
AATTATGACATACCCTCTTCTGTTGAAACATACTATCATAGGATAGGGAGAACTGGAAGG
TATGGAAGATTTGGGATAAGTATAATTTTGGTTCAATAAAATGAAGAAAATTTTATTCAG
TAAAATATAATACATTTTTGCAGATTATAAGACCTGCCTTAAAATTTCTCTGATATAAAT
TTAAGACTGGAATAGAAGCTAGCTGATCTTAACTAAGGTAACAATCTAAAATAATCGGAG
AATTAGTCATTGGAGAAACAAGAAAAAAGTCTATCATCCAACTAAAAGAAAAATCTAAAG
AATAATCCTTAAAACTATCACCATGAATTTACTCAAGGAATACTAATGAAAGAAGTAGAT
GTCAATGAAAAGTTTTACGATGAATCTACTTTTAAATATTTTGAGGAAGAAGAATGCTCA
CCCATTTTGCTAAATGGATAAACTGAACTCTCAGGATCCATGTTTTCAGATGAAGATGAT
ATAGATAATGATATTGAAGAAGAAGAAGATGATGATTATTCATATGAAAATTAAGATGAA
TCAAGTCTTGAAAAATAAGCAGCAGATATTAAAGGTGAAAAATAAAATATAATTTCTAAT
AAAAAAAATCATATTTGCTAAGATAAAAGTGAATGGGGATTCCTTTCATGCTAGGTTTGC
TACGAATTTCTTTTAGAGTCAGAACATTATTTAAATAAAAAATTTGAAATAACAAAGTAC
TTTAATGTAAAAAAAGTTAAATAAATTAAAGCTGATTGA


>TTHERM_00371290(gene)
ATGAATTAACAAGACAACTTCAACACAGAAATCTCTCATAAATAAATAAAATCTTTTCAC
TAACTTAAATTATCTTCAGGAGACTATTTACGTGCATTAGAGAAGCTACACTTTACCGAG
CCAACTCCAATTTAAATACTTTCAATACCTGAAGGTTTGACAGAAAAGAACATTATTGCA
TAGGCTAAAGCAGGAACAGGAAAAACTTTAGCTTTTAGCAGTATTATACTCGAAAAATTG
ATAAATAGGAGGCAAACAATATTTTAAGATTCAAATCCATTAGTCTTAATTATATTACCT
ACAAGAGAGTTAGCAATTCAGGTATTCGAATTTATTCAGCAACTATTAAAGGCTCTAAAT
ACTATAAATCCTAATTTATTACCTTATGTTAATTGCGGAATCTTTATTGGAGGACTACCA
CTGCAAGATGATAGGAGAAATCTCAAAATACAGCATGTAAAAATAATAATTGGAACAATA
GGAAGAATTGTAGCTCTAATAAAAGAAAATTCATTGGTACTTTCTTCAATAAACACCCTT
GTGCTAGATGAGGCAGATAAACTAATGGGATAAAAAGACTTTTACAAACACATAACTTAT
ATATTTGATGCTTTAAATAAGTAGACTCTAAATAATATATCTATTAGTAGTTAATTAGAT
ATCAACAGTAATATAGAAGAATTAAAGTCATAATAAGAATAAACTCTAATTTAAGATGAA
AAAGAAACTGCTTTTGAAGTTCTTCAAAGGAGGAAAAAAAACTTAAAGTTACCTGTTTAA
TACTTAGCTTATTCGGCAACTTACCCTGATGATCTCAAATAAAAAATTGAGAAATTGATG
GAAACAAGTGTATTTGTAGACGCAATTTAATTATAAAATTAAAGTGATTCACAGAGCACT
GAAAATTAACAGAATGATAATAGAGATTTGAATCTAGAAAATATCATTTAATATAGAGTT
GATGTAAAATAGGAAGGAAATGTTTCAGTAACAAAACAAAAAATAAATATTCTCACAAGT
GTTTTAAAGTAGATTAAGTTTAATCAAGCAATAATATTTTACAATGATAAAATCAAAGGA
GAAAATATTTTTAGTGAACTTAAAGCTTAAAATTATTCTGTTATCTTTATTCATGGAGAT
TAAACTTAGGCAGATAGAATCAAAGTTATGAACTAAATTCGTAGAAATAAAACTTAAATT
ATAATTTCTACTGACTTACTTTCAAGAGGTATTGACATCACTACTATTGATTTAGTTATA
AATTATGACATACCCTCTTCTGTTGAAACATACTATCATAGGATAGGGAGAACTGGAAGG
TAAAAAATTATATTCTTATTTCAAAAAAACTGGTCAAGAAGAACAATGAATAATAAAAAA
TAATATTTTTTATAGCATTTTAGAAACAGCCACATTTTCAATATTTTTTTATTAGAAAGA
TAATTAGAGGCCTGATTTTTTAATTTTTAAATGCACATAAAGAAAATTTTATATTTTTGG
ATTAAATAAAAATGAATTTATTGTTGAAAAAAGCATAAAATGATATGAAAAATACTTTTT
TTAAAAATTATCATGTATAAAATAGGTATGGAAGATTTGGGATAAGTATAATTTTGGTTC
AATAAAATGAAGAAAATTTTATTCAGTAAAATATAATACATTTTTGCAGATTATAAGACC
TGCCTTAAAATTTCTCTGATATAAATTTAAGACTGGAATAGAAGCTAGCTGATCTTAACT
AAGGTAACAATCTAAAATAATCGGAGAATTAGTCATTGGAGAAACAAGAAAAAAGTCTAT
CATCCAACTAAAAGAAAAATCTAAAGAATAATCCTTAAAACTATCACCATGAATTTACTC
AAGGAATACTAATGAAAGAAGTAGATGTCAATGAAAAGTTTTACGATGAATCTACTTTTA
AATATTTTGAGGAAGAAGAATGCTCACCCATTTTGCTAAATGGATAAACTGAACTCTCAG
GATCCATGTTTTCAGATGAAGATGATATAGATAATGATATTGAAGAAGAAGAAGATGATG
ATTATTCATATGAAAATTAAGATGAATCAAGTCTTGAAAAATAAGCAGCAGATATTAAAG
GTGAAAAATAAAATATAATTTCTAATAAAAAAAATCATATTTGCTAAGATAAAAGTGAAT
GGGGATTCCTTTCATGCTAGGTTTGCTACGAATTTCTTTTAGAGTCAGAACATTATTTAA
ATAAAAAATTTGAAATAACAAAGTACTTTAATGTAAAAAAAGTTAAATAAATTAAAGCTG
ATTGA


>TTHERM_00371290(protein)
MNQQDNFNTEISHKQIKSFHQLKLSSGDYLRALEKLHFTEPTPIQILSIPEGLTEKNIIA
QAKAGTGKTLAFSSIILEKLINRRQTIFQDSNPLVLIILPTRELAIQVFEFIQQLLKALN
TINPNLLPYVNCGIFIGGLPLQDDRRNLKIQHVKIIIGTIGRIVALIKENSLVLSSINTL
VLDEADKLMGQKDFYKHITYIFDALNKQTLNNISISSQLDINSNIEELKSQQEQTLIQDE
KETAFEVLQRRKKNLKLPVQYLAYSATYPDDLKQKIEKLMETSVFVDAIQLQNQSDSQST
ENQQNDNRDLNLENIIQYRVDVKQEGNVSVTKQKINILTSVLKQIKFNQAIIFYNDKIKG
ENIFSELKAQNYSVIFIHGDQTQADRIKVMNQIRRNKTQIIISTDLLSRGIDITTIDLVI
NYDIPSSVETYYHRIGRTGRYGRFGISIILVQQNEENFIQQNIIHFCRLQDLPQNFSDIN
LRLEQKLADLNQGNNLKQSENQSLEKQEKSLSSNQKKNLKNNPQNYHHEFTQGILMKEVD
VNEKFYDESTFKYFEEEECSPILLNGQTELSGSMFSDEDDIDNDIEEEEDDDYSYENQDE
SSLEKQAADIKGEKQNIISNKKNHICQDKSEWGFLSCQVCYEFLLESEHYLNKKFEITKY
FNVKKVKQIKAD