Identifiers and Description

Gene Model Identifier

TTHERM_00372550

Standard Name

PARP11 (Poly(ADP-Ribosyl) transferase 11)

Aliases

PreTt28669 | 39.m00242 | 3693.m00088

Description

poly(ADP-ribose) polymerase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12304.1 1.0004025422005049e-134
Description: hypothetical protein (289 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:30796450: Ashraf K, Nabeel-Shah S, Garg J, Saettone A, Derynck J, Gingras AC, Lambert JP, Pearlman RE, Fillingham J (2019) Proteomic analysis of histones H2A/H2B and variant Hv1 in Tetrahymena thermophila reveals an ancient network of chaperones. Molecular biology and evolution ( ):

Sequences

>TTHERM_00372550(coding)
ATGAATGAATACAAGATAGTTTTTATAGTTTTATTTCTTTATGGCTGCTATAATTTGAAT
TACTTCTATAATTAAAACATTTTGAATAAATTAAATGTTTCTTTCTATTTAGTAGTAATT
TGCTTTGCTATTTATGGCTTCTTTTATATAGGTAGCGATAGCAATATATAATCAACTAGA
AGTCAAAAATAATCAAACAATATTTAAAATAATTAGAAAAATAAAATAAATAACCTTTAA
AATGAGGTAAAAATTATTAAAATATCTCAAGATAAGTATGAAACAATACTTAAAAAATTA
TAATTTGATGACCAAGTTCTTTAAAATAGCAAATTCTCCCTGGAAAGTATTTACAAAGTA
AAAAATAAAGCAATTAAGAAGAGATTTCTAGAGTACTAAAAAAATAAGACAGAAAAAGTT
AAACTTTTTGGATAATGCGGTCCTGCTTATACAAATTTTGGATATCATGGAACTAAAAAA
ACATGTGTTGGATTTGAAAAAATTTGCACTATAAAGGATGATTGTCCTTTCTGCAGTATT
CTAACGTTTGGGTTTAGAAACGCATTTTCAGGCAAAAGCATGAGTCTTATATTAAGATAT
GGAAAAGGTACATACTTTAGTCCAAAATTATAAAAAGCTCTCAATTATTGCCAGTCAGAT
TAAAAAATAATATTAGCATGTAAAATAGTAATGGGTCGTGTTTTTAAGCCATCTTGCATC
GATGATTATTTTATGTAATTTGATGGAAGTAAGTATGATTGTATTGATGCAGATCCTCAA
TATACTATTGATATTAGAGATCCAGAAATATGCATTAAAAATGAGAAAGCTTGTTTACCA
AAATATATCTTAGTTTTTAAATGA


>TTHERM_00372550(gene)
ATGAATGAATACAAGATAGTTTTTATAGTTTTATTTCTTTATGGCTGCTATAATTTGAAT
TACTTCTATAATTAAAACATTTTGAATAAATTAAATGTTTCTTTCTATTTAGTAGTAATT
TGCTTTGCTATTTATGGCTTCTTTTATATAGGTAGCGATAGCAATATATAATCAACTAGA
AGTCAAAAATAATCAAACAATATTTAAAATAATTAGAAAAATAAAATAAATAACCTTTAA
AATGAGGTAAAAATTATTAAAATATCTCAAGATAAGTATGAAACAATACTTAAAAAATTA
TAATTTGATGACCAAGTTCTTTAAAATAGCAAATTCTCCCTGGAAAGTATTTACAAAGTA
AAAAATAAAGCAATTAAGAAGAGATTTCTAGAGTACTAAAAAAATAAGACAGAAAAAGTT
AAACTTTTTGGATAATGCGGTCCTGCTTATACAAATTTTGGATATCATGGAACTAAAAAA
ACATGTGTTGGATTTGAAAAAATTTGCACTATAAAGGATGATTGTCCTTTCTGCAGTATT
CTAACGTTTGGGTTTAGAAACGCATTTTCAGGCAAAAGCATGAGTCTTATATTAAGATAT
GGAAAAGGTACATACTTTAGTCCAAAATTATAAAAAGCTCTCAATTATTGCCAGTCAGAT
TAAAAAATAATATTAGCATGTAAAATAGTAATGGGTCGTGTTTTTAAGCCATCTTGCATC
GATGATTATTTTATGTAATTTGATGGAAGTAAGTATGATTGTATTGATGCAGATCCTCAA
TATACTATTGATATTAGAGATCCAGAAATATGCATTAAAAATGAGAAAGCTTGTTTACCA
AAATATATCTTAGTTTTTAAATGA


>TTHERM_00372550(protein)
MNEYKIVFIVLFLYGCYNLNYFYNQNILNKLNVSFYLVVICFAIYGFFYIGSDSNIQSTR
SQKQSNNIQNNQKNKINNLQNEVKIIKISQDKYETILKKLQFDDQVLQNSKFSLESIYKV
KNKAIKKRFLEYQKNKTEKVKLFGQCGPAYTNFGYHGTKKTCVGFEKICTIKDDCPFCSI
LTFGFRNAFSGKSMSLILRYGKGTYFSPKLQKALNYCQSDQKIILACKIVMGRVFKPSCI
DDYFMQFDGSKYDCIDADPQYTIDIRDPEICIKNEKACLPKYILVFK