Identifiers and Description

Gene Model Identifier

TTHERM_00375010

Standard Name

FAA2  (Fatty Acid Activation  )

Aliases

PreTt28715 | 39.m00288 | 3693.m00130

Description

AMP-binding enzyme family protein; Medium chain fatty acyl-CoA synthetase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00501 ) AMP-binding enzyme
  • ( TIGR01733 ) amino acid adenylation domain
  • ( TIGR01734 ) D-alanine--poly(phosphoribitol) ligase, subunit 1
  • ( TIGR01923 ) O-succinylbenzoate-CoA ligase
  • ( TIGR02262 ) benzoate-CoA ligase family
  • ( TIGR02275 ) (2,3-dihydroxybenzoyl)adenylate synthase
  • ( TIGR03098 ) acyl-CoA ligase (AMP-forming), exosortase system
  • ( TIGR03205 ) dicarboxylate--CoA ligase PimA
  • ( TIGR03208 ) cyclohexanecarboxylate-CoA ligase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_12344.1 9.997093137033517e-262
Description: AMP-binding enzyme family protein (670 aa)
Oxytricha Contig16208.0.g92 2.9994339188023638e-146
Description: AMP-binding enzyme
WormBase WBGene00022037 3.000615301710693e-133
Description: locus:acs-13 status:Confirmed UniProt:V6CK48 protein_id:CDK13414.1
DictyBase DDB_G0269242 2.9990837046884738e-127
Description: fcsA on chromosome: 1 position 2990411 to 2993319
SGD YER015W 5.0023264312997875e-87
Description: FAA2 Medium chain fatty acyl-CoA synthetase, activates imported fatty acids; accepts a wide range of fatty acid chain lengths with a preference for medium chains, C9:0-C13:0; localized to the peroxisome
Stentor Coeruleus SteCoe_29121 4.408531331463226e-71
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00375010(coding)
ATGGCTTCTATTCTTTATTCCATGTTCAAAGGAACAAACAACGATAACAAACACATTTAC
TGCAAACCTTACTCTGAAGCTAAAGATGGTCATAGTGCTGTTTATAGATCCAAGAATCAA
TTCGACCAATTGAAATTGGTTCCTGATGATGAATGTACTACTATGCAAGACATTTTCTTG
AGATCATGCAGATTGTACTCTCATAAGAGTTTCTTAGGAACTATCGATCCTTCTCATAAG
CATTACAATTGGAAGAACTTTAAGGAAATTAAGCAATTAGCTGAATACTTGGGTTCCAAC
GTTAACTAAAAGAAGCTCTTCACTCATGTCAATGACTTTGAAAATATTAACATGGACTTA
ATTGGTGTTTTCTCCAAAAACAGAGAAGAATGGTTGGTTCTTGAATATTCCAACTTTTTA
TATCGCAAGACCATGGTTCCCTTATATGATACCCTTGGACCTGAATCAATTACCTACATT
CTTGACTAGACTGGAATAGAAACAGTATTTAGTGCAGTAGAAGGTGTCGATGCTCTCTTG
AAAAGCAAGGACATTTGCAAACTCAAGAACATTGTCCTCTTTGACGAAATCCCTGAAGAA
AAGAAAGAAAAGCTCACACAAAGAGGTCTCACTTTATATAGTTACAAGGATTTGATTGCC
CCCACTTAAGTAGATGAGTACGCAAAATGCTTACCTGAAGACGTTATAACTTTCTCTTAT
ACCTCAGGTACAACTGGCTTCCCCAAAGGTGCTATGATTACTAACAAGAATCTTGTCTCT
GTTATTGCTATTGCAAAGGAAGAAGATTTTCAAACTGGAGATATTTATTTATCTTACTTA
CCTCTTCCTCATATTTTAGAACGTATCGCTGTCAGTTCTATGCTCTACTTGGGTATCCAA
ATCGGTTTTTACAGAGGTGATACTAGATAATTGAAAGAAGACTTAGAATTATTAAAGCCT
ACTATTTTTGCTAGTGTTCCTAGAGTGTATAACAGATTTTATGACATGATCAAAGCTAAA
TTCAATTAAGCTAAAGGTATCTAAGGCTGGTTATTAGCTAAGGGTTTAGCAGCTAAATTG
CAAAATTCCAAAAATGGTTAATACACTCATATGCTCTATGATAAGTTGATTTTCAACAAG
GTAAAACAAGCATTAGGTGGTAATGTTAGAGTTGCAGTAGTTGGTGGTGCTCCTATTAGT
GGAGAAGTACTCACTTTTATGAGAGCCTGTCTTTGTATTCCTATCCTTGAAGGTTACGGT
TAAACTGAAAGTACTGGTGCAGCTTTTAGTACTCATGCTTCTGATGGTACTACTGGACAT
ATTGGTGGATGCAGAGGACACATGGAGTACAAGCTTGTTGATATCCCTGAAATGGGTTAT
ACTGCTAAGGACACAGATAAAGACGGAAAACCTACCCCTAGAGGAGAAATTTGTGTTAGA
GGTTATGGTGTTTTTGCTGGCTATTACAAGTAAAAGGATAAAACAGAAGAAATTATAGAT
GCTGATGGTTGGTTGCATAGTGGTGACGTTGGTAGAATTGACCATGAAAGAGGTTGCTTA
ACTATCATTGACAGAAAGAAAAATATCTTTAAACTTGCTTAAGGTGAATACATTGCTCCA
GATAAAATCGAAAATATCTACTTAAGAGCAGCTGGTGTTGAAGAAGTATTTGTTTATGGT
GATTCTTTACAATCCACTTTAGTTTCAATTGTTGTACCTTCAAAGGATTTCTTAAAGAAG
TTTGCTGAATCTAAAGGACTTGAAAATAATGTTTAATAGCTTTGCTAAAACAAAGAAGTC
ATTAAAACTATTTTAGACAACATGACAAAGCTTGGTAAAGCTGAAGGTCTCTTCTCATTT
GAATAAGTTAAGAGCTTACACTTATTCCCTGAATCATTCTAAACAATAGATTGTATGACT
AACACCCTTAAAATTAAGCGTAAGGAATGTAGAGATTATTTCAGAGATACAATTGATAAA
TTATATGCTGAATAAGGTCCTGCATAATGA


>TTHERM_00375010(gene)
ATGGCTTCTATTCTTTATTCCATGTTCAAAGGAACAAACAACGATAACAAACACATTTAC
TGCAAACCTTACTCTGAAGCTAAAGATGGTCATAGTGCTGTTTATAGATCCAAGAATCAA
TTCGACCAATTGAAATTGGTTCCTGATGATGAATGTACTACTATGCAAGACATTTTCTTG
AGATCATGCAGATTGTACTCTCATAAGAGTTTCTTAGGAACTATCGATCCTTCTCATAAG
CATTACAATTGGAAGAACTTTAAGGAAATTAAGCAATTAGCTGAATACTTGGGTTCCAAC
GTTAACTAAAAGAAGCTCTTCACTCATGTCAATGACTTTGAAAATATTAACATGGACTTA
ATTGGTGTTTTCTCCAAAAACAGAGAAGAATGGTTGGTTCTTGAATATTCCAACTTTTTA
TATCGCAAGACCATGGTTCCCTTGTAAGTTTAGATTATTCATATATATTTACAAATAAAG
ATTAAAATAAACTAGGATTTTTTGCAAAAATTAGCTTGTTTCTAATAAAATTTGAATTAC
TTTTTCAACACCTCCATATTTTTGGAAATTTATTTATAAGAGTCTGAAATTTATTAATAC
TTATTAAAATTAAAATAAAAAGATATGATACCCTTGGACCTGAATCAATTACCTACATTC
TTGACTAGACTGGAATAGAAACAGTATTTAGTGCAGTAGAAGGTGTCGATGCTCTCTTGA
AAAGCAAGGACATTTGCAAACTCAAGAACATTGTCCTCTTTGACGAAATCCCTGAAGAAA
AGAAAGAAAAGCTCACACAAAGAGGTCTCACTTTATATAGTTACAAGGATTTGATTGCCC
CCACTTAAGTAGATGAGTACGCAAAATGCTTACCTGAAGACGTTATAACTTTCTCTTATA
CCTCAGGTACAACTGGCTTCCCCAAAGGTGCTATGATTACTAACAAGAATCTTGTCTCTG
TTATTGCTATTGCAAAGGAAGAAGATTTTCAAACTGGAGATATTTATTTATCTTACTTAC
CTCTTCCTCATATTTTAGAACGTATCGCTGTCAGTTCTATGCTCTACTTGGGTATCCAAA
TCGGTTTTTACAGAGGTAACTAATTATTTTGACATATTTTAGCAAATTTATAAAAATAGC
ATTAAAAAGAAAGTGCATTAAAAAGTTAATTGAAATTTTATTTAAGAATAAGGCTTAAGC
TTTAAACATTCAAAATAGGACTTATTTAATCAAATTAATAATATAATTAAAGCAATAAAC
TATTTAAATTTTTTATCAGAAAATTCTGGGTTTAATCTAAAAATAAATAGAAGCGAATAA
TAAATATTTAATTAGCTTTAGATTAAAAAAAAAAATTAATAATTTTTCTATTTAACTGAT
TAGGTGATACTAGATAATTGAAAGAAGACTTAGAATTATTAAAGCCTACTATTTTTGCTA
GTGTTCCTAGAGTGTATAACAGATTTTATGACATGATCAAAGCTAAATTCAATTAAGCTA
AAGGTATCTAAGGCTGGTTATTAGCTAAGGGTTTAGCAGCTAAATTGCAAAATTCCAAAA
ATGGTTAATACACTCATATGCTCTATGATAAGTTGATTTTCAACAAGGTAAAACAAGCAT
TAGGTGGTAATGTTAGAGTTGCAGTAGTTGGTGGTGCTCCTATTAGTGGAGAAGTACTCA
CTTTTATGAGAGCCTGTCTTTGTATTCCTATCCTTGAAGGTTACGGTTAAACTGAAAGTA
CTGGTGCAGCTTTTAGTACTCATGCTTCTGATGGTACTACTGGACATATTGGTGGATGCA
GAGGACACATGGAGTACAAGCTTGTTGATATCCCTGAAATGGGTTATACTGCTAAGGACA
CAGATAAAGACGGAAAACCTACCCCTAGAGGAGAAATTTGTGTTAGAGGTTATGGTGTTT
TTGCTGGCTATTACAAGTAAAAGGATAAAACAGAAGAAATTATAGATGCTGATGGTTGGT
TGCATAGTGGTGACGTTGGTAGAATTGACCATGAAAGAGGTTGCTTAACTATCATTGACA
GAAAGAAAAATATCTTTAAACTTGCTTAAGGTGAATACATTGCTCCAGATAAAATCGAAA
ATATCTACTTAAGAGCAGCTGGTGTTGAAGAAGTATTTGTTTATGGTGATTCTTTACAAT
CCACTTTAGTTTCAATTGTTGTACCTTCAAAGGATTTCTTAAAGAAGTTTGCTGAATCTA
AAGGACTTGAAAATAATGTTTAATAGCTTTGCTAAAACAAAGAAGTCATTAAAACTATTT
TAGACAACATGACAAAGCTTGGTAAAGCTGAAGGTCTCTTCTCATTTGAATAAGTTAAGA
GCTTACACTTATTCCCTGAATCATTCTAAACAATAGATTGTATGACTAACACCCTTAAAA
TTAAGCGTAAGGAATGTAGAGATTATTTCAGAGATACAATTGATAAATTATATGCTGAAT
AAGGTCCTGCATAATGA


>TTHERM_00375010(protein)
MASILYSMFKGTNNDNKHIYCKPYSEAKDGHSAVYRSKNQFDQLKLVPDDECTTMQDIFL
RSCRLYSHKSFLGTIDPSHKHYNWKNFKEIKQLAEYLGSNVNQKKLFTHVNDFENINMDL
IGVFSKNREEWLVLEYSNFLYRKTMVPLYDTLGPESITYILDQTGIETVFSAVEGVDALL
KSKDICKLKNIVLFDEIPEEKKEKLTQRGLTLYSYKDLIAPTQVDEYAKCLPEDVITFSY
TSGTTGFPKGAMITNKNLVSVIAIAKEEDFQTGDIYLSYLPLPHILERIAVSSMLYLGIQ
IGFYRGDTRQLKEDLELLKPTIFASVPRVYNRFYDMIKAKFNQAKGIQGWLLAKGLAAKL
QNSKNGQYTHMLYDKLIFNKVKQALGGNVRVAVVGGAPISGEVLTFMRACLCIPILEGYG
QTESTGAAFSTHASDGTTGHIGGCRGHMEYKLVDIPEMGYTAKDTDKDGKPTPRGEICVR
GYGVFAGYYKQKDKTEEIIDADGWLHSGDVGRIDHERGCLTIIDRKKNIFKLAQGEYIAP
DKIENIYLRAAGVEEVFVYGDSLQSTLVSIVVPSKDFLKKFAESKGLENNVQQLCQNKEV
IKTILDNMTKLGKAEGLFSFEQVKSLHLFPESFQTIDCMTNTLKIKRKECRDYFRDTIDK
LYAEQGPAQ