Identifiers and Description

Gene Model Identifier

TTHERM_00375030

Standard Name

CTH51 (CaTHepsin 51)

Aliases

PreTt28717 | 39.m00290 | 3693.m00132

Description

CTH51 papain family cysteine protease

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Biological Process

Domains

  • ( PF00112 ) Papain family cysteine protease
  • ( PF08246 ) Cathepsin propeptide inhibitor domain (I29)

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_08896.1 9.002652247498986e-153
Description: papain family cysteine protease containing protein (352 aa)
Oxytricha Contig19008.0.g54 2.000065869309806e-55
Description: Papain family cysteine protease
DictyBase DDB_G0281605 9.995739965151785e-43
Description: cfaD on chromosome: 3 position 4701100 to 4702904
WormBase WBGene00007055 5.998886722426197e-42
Description: locus:tag-196 status:Confirmed UniProt:O16454 protein_id:CCD64084.1
Stentor Coeruleus SteCoe_29480 5.242885663363464e-22
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00375030(coding)
ATGAACTCAAAGATATTTGTTGCTATTACTTTAATCCTACTTGGAATTCAATGTGTCTCT
GCATTTGATGAAAGAGCTTTTGGAGAAGAAGCTGCTAAATTAATAACTGTTTAGGGTTTA
CACAACTTTAACAAATGGGAAAGAAGCTTTAGCTCAGGACGTAGTCGTACCTATCTATCA
GAAGAAGAAAGAACTTACCGTCAAATTGTTTTCCTTTAGAATGATTAGAATATCTAAAAA
CACAACAGTGACAGCAACAATACTTACAAGCTTTAACACAACCAGTTCTCTGACATGACA
AAAGATGAATTTGCCCATCGTGTCCTTAATTCCTAACTCAAAACTTCTGCATCTTCTTCT
TCTTAACCTGCTTAAACTCCCTAACTAAGAGGAAGTGTAGATGCTAGTTTGAATGCAAGT
CAAGGATTTGACTGGAGAAATTACTAAGGTGTTCTTGGTAATGTTAAAAATTAAGGTTAG
TGTGGTTCATGCTGGACATTTGCAACTGCAGGTGTTTTAGAATCCTATTATGCTCTTAAG
TATCAATAATCTCTTATTTTCTCTGAATAAGATATTGTTGATTGCGCTTCACGTTCTTAT
GGCTATTAATCTGATGGTTGCAATGGCGGTTTCCCCAGCGAAGGATTACAATATGCATCC
ACAGTTGGTCTAGTTTAATCTGATTACTATCCTTATGTTGCTGTCTAAGGTACTTGCAGA
TAAGTCAATGCTCCTCGTTATCAGTTGTTAGATTAATACTACTCAGTATAATAATCTTCC
AGTGCACTTTAGTATGCAATTACAAGAGCTCCTACTGCTGTTGGTGTAGATGCTAGTACT
TGGTAATTCTACAATAGTGGTGTTTATAACGGTTGTGGTAAAACTTAAAGAAATCAATTA
AATCACGCTGTTATTGCAGTTGGTTATGATGCCTACGGAAACTGGATTATTAGAAACTCA
TGGGGCACAAGCTGGGGACAAAGTGGTTATATTACTCTTGCTAGAGGAAATACTTGTGGT
GTTCTCTATGATAACTATGCCATAAATATTTGA


>TTHERM_00375030(gene)
ATGAACTCAAAGATATTTGTTGCTATTACTTTAATCCTACTTGGAATTCAATGTGTCTCT
GCATTTGATGAAAGAGCTTTTGGAGAAGAAGCTGCTAAATTAATAACTGTTTAGGGTTTA
CACAACTTTAACAAATGGGAAAGAAGCTTTAGCTCAGGACGTAGTCGTACCTATCTATCA
GAAGAAGAAAGAACTTACCGTCAAATTGTTTTCCTTTAGAATGATTAGAATATCTAAAAA
CACAACAGTGACAGCAACAATACTTACAAGCTTTAACACAACCAGTTCTCTGACATGACA
AAAGATGAATTTGCCCATCGTGTCCTTAATTCCTAACTCAAAACTTCTGCATCTTCTTCT
TCTTAACCTGCTTAAACTCCCTAACTAAGAGGAAGTGTAGATGCTAGTTTGAATGCAAGT
CAAGGATTTGACTGGAGAAATTACTAAGGTGTTCTTGGTAATGTTAAAAATTAAGGTTAG
TGTGGTTCATGCTGGACATTTGCAACTGCAGGTGTTTTAGAATCCTATTATGCTCTTAAG
TATCAATAATCTCTTATTTTCTCTGAATAAGATATTGTTGATTGCGCTTCACGTTCTTAT
GGCTATTAATCTGATGGTTGCAATGGCGGTTTCCCCAGCGAAGGATTACAATATGCATCC
ACAGTTGGTCTAGTTTAATCTGATTACTATCCTTATGTTGCTGTCTAAGGTACTTGCAGA
TAAGTCAATGCTCCTCGTTATCAGTTGTTAGATTAATACTACTCAGTATAATAATCTTCC
AGTGCACTTTAGTATGCAATTACAAGAGCTCCTACTGCTGTTGGTGTAGATGCTAGTACT
TGGTAATTCTACAATAGTGGTGTTTATAACGGTTGTGGTAAAACTTAAAGAAATCAATTA
AATCACGCTGTTATTGCAGTTGGTTATGATGCCTACGGAAACTGGATTATTAGAAACTCA
TGGGGCACAAGCTGGGGACAAAGTGGTTATATTACTCTTGCTAGAGGAAATACTTGTGGT
GTTCTCTATGATAACTATGCCATAAATATTTGA


>TTHERM_00375030(protein)
MNSKIFVAITLILLGIQCVSAFDERAFGEEAAKLITVQGLHNFNKWERSFSSGRSRTYLS
EEERTYRQIVFLQNDQNIQKHNSDSNNTYKLQHNQFSDMTKDEFAHRVLNSQLKTSASSS
SQPAQTPQLRGSVDASLNASQGFDWRNYQGVLGNVKNQGQCGSCWTFATAGVLESYYALK
YQQSLIFSEQDIVDCASRSYGYQSDGCNGGFPSEGLQYASTVGLVQSDYYPYVAVQGTCR
QVNAPRYQLLDQYYSVQQSSSALQYAITRAPTAVGVDASTWQFYNSGVYNGCGKTQRNQL
NHAVIAVGYDAYGNWIIRNSWGTSWGQSGYITLARGNTCGVLYDNYAINI