Identifiers and Description

Gene Model Identifier

TTHERM_00377350

Standard Name

MRNC16 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt10288 | 40.m00173

Description

kinase domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00127.1 9.997093137033517e-262
Description: hypothetical protein (701 aa)
Oxytricha Contig12543.0.g89 0.000000000010004361180063202
Description: MORN repeat
WormBase WBGene00002179 0.00020003864201578029
Description: locus:jph-1 status:Confirmed UniProt:Q22667 protein_id:CAA99924.2

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00377350(coding)
ATGAACTTTGTTTCTCCTTAAATAGTCTAATAAACTCCTAAATTATAAATTCAAGGAGGG
TTTCCTTTAGGAAGAGTTGTCAGTCCTTTCTAAAGTCCATATTTGCAGCAAAACCCAATA
CCTTAAGCAGGAGGATTTGTATCTTAGCCTTATTAGATACATCCATAGATATAGTCGGGA
GTTAGTTCTCCTATGATGAGAAGCAATTTAAGTGTTTTTTAGCAAGGTCAAATACCTTAA
CAAAATAGAACTTCAAATTCATAGGCTGATCTAGGTTAGTACTTGAGATCTCCACAATCA
ACTTAGAAATAGGAAAATTAGCTGCAAAGATATTAAAATACTGAACCGATTAAGAAATAA
ATAGCCTCAAATCAGCATTTTATTTCTCCTTAATACATATAATAATAGACTAATACAGGT
TAATACATTCAAAGCAATCAGACTTAAAAAATTTAAAGATAGACATCATTCCATTAATAG
CAATTATAAAATAGCAGATTAACAATGCAATCTCTTCCTGCAAATAACAATACAATTAAC
ATTACATCTGCAACTTCCCCTAACGAAAGACTTCTAAGTCGTAATTTATCTCCTTAGCCA
TCCCATAGATTAAATTCATTACTCTCCTCTCCAATATAGAGAGCTATCTCACCTTAAACT
TAAAGGATAAATAAAGATTCATTCAATGGCACAGTGTAAACAGCTAATTAAAATCAATTA
GTCACTCAATAAGGCCCATACATGCTTGGTGTCGCTCAAACCCTATACACTCCATCGTCA
AGAGCTTAATCACCAACTTTTAATTAAAATTAGGGTTTCATGTTTACTGGCAGAAATAAC
TTTGTTTAATCTCCATAACAAACATTTTATTCAAGCGGTTAAAATTTTTACAAAACTAAC
TCCATGCCTTAATAACAGCAGTAATAATTTATTCCATTCAAACTAGAACTTCCTCAAAAA
GTGCAGGACAATTAATAAAAGCTTAATGAAGCCATAGCAAAATCTGAAAAAGTTAAAAAA
TTAGTTGCTGAAAAACAGCAATAAATGAAAGCCAACGAACAAAAGAGGTAAGAATTACTA
GATGTGTCAAAATTATATGATTTAACTCCATAGTAAACAGCAGAAAAAGTAAAAAATAAG
CAGTAAACACCTATAAAGCAAGAGGAATCGCCTATTAAAACTATTCAATAAGTTATAAAT
ACAAATAAATAAGGTCCATAAAAGCATATAATAAATAGTATAGTTAACAGCGATAACAAA
AATATGATTCCGATTGGAACTATTGCAAATTAAAATAATTCTATTTCTAATCCTTAAACT
TCATATGCACAAAGACAAGCTGAAAATTTGCATATTTCTATTTCACAAAATGGAAATACA
GAAGAAAGCGAACAAACATTAAACTAAATTTCTCAAAACTAAGCAGAATTTAAAAAACTT
TAACTAGAATTTAAAAATTCTGTGAATAAAATAAAGGAGACACCTAAGCAATAGCTTATA
TAAACTCCAATAAGCCTTTTATAAAAATCCAATCTAAAGCTGGATTAAAGTTAGCCAAAT
GAAAATAAAGAAAATTGTATTATCTCAACTCCCATCACTAATAATTAAAATGGAGATCAA
ACTCCTACTGGTGATTAAAAAATAGAATTCAAAAGTACTGTGAATTAATTCAGGAAATCC
TTCTAAAAAAATATGTATTAAACTCCTTAAAACTCAAAAAAGAAATTTTAAAAGAAAGTC
TATGAAAACGAAGATGAGTACTAAGGTAGCATGGAAAATGATATTCCTAATGGCTACGGC
ATTCTTAGAGATAAAAATGGAAAAGAACTCTACAAAGGAGACTGGAAAAACGGATAATAT
GATGGAAGTGGTATATTGGTAAATAGAAATCAAAACGATAGTTAAGCAATTGTGATTGAT
CATAATGAGCTTTCATAAATATTAACCTTAAACTTATGGATTAGATATGAAGGTGATATG
AAACAAAACTAAATATAAGGCTTTGGAACTATGTATTTTATAGATAATTTAAAATACGTT
GGAAATTTTGCTTAAGGTATTCCTGAAGGCTAAGGCTCTTTTTACACAAATGATGGAAAA
GTTATTGCTGGAGTATGGGAATAAGGAAAATTGAAAGATATTCTCTGGGATTGA


>TTHERM_00377350(gene)
ATGAACTTTGTTTCTCCTTAAATAGTCTAATAAACTCCTAAATTATAAATTCAAGGAGGG
TTTCCTTTAGGAAGAGTTGTCAGTCCTTTCTAAAGTCCATATTTGCAGCAAAACCCAATA
CCTTAAGCAGGAGGATTTGTATCTTAGCCTTATTAGATACATCCATAGATATAGTCGGGA
GTTAGTTCTCCTATGATGAGAAGCAATTTAAGTGTTTTTTAGCAAGGTCAAATACCTTAA
CAAAATAGAACTTCAAATTCATAGGCTGATCTAGGTTAGTACTTGAGATCTCCACAATCA
ACTTAGAAATAGGAAAATTAGCTGCAAAGATATTAAAATACTGAACCGATTAAGAAATAA
ATAGCCTCAAATCAGCATTTTATTTCTCCTTAATACATATAATAATAGACTAATACAGGT
TAATACATTCAAAGCAATCAGACTTAAAAAATTTAAAGATAGACATCATTCCATTAATAG
CAATTATAAAATAGCAGATTAACAATGCAATCTCTTCCTGCAAATAACAATACAATTAAC
ATTACATCTGCAACTTCCCCTAACGAAAGACTTCTAAGTCGTAATTTATCTCCTTAGCCA
TCCCATAGATTAAATTCATTACTCTCCTCTCCAATATAGAGAGCTATCTCACCTTAAACT
TAAAGGATAAATAAAGATTCATTCAATGGCACAGTGTAAACAGCTAATTAAAATCAATTA
GTCACTCAATAAGGCCCATACATGCTTGGTGTCGCTCAAACCCTATACACTCCATCGTCA
AGAGCTTAATCACCAACTTTTAATTAAAATTAGGGTTTCATGTTTACTGGCAGAAATAAC
TTTGTTTAATCTCCATAACAAACATTTTATTCAAGCGGTTAAAATTTTTACAAAACTAAC
TCCATGCCTTAATAACAGCAGTAATAATTTATTCCATTCAAACTAGAACTTCCTCAAAAA
GTGCAGGACAATTAATAAAAGCTTAATGAAGCCATAGCAAAATCTGAAAAAGTTAAAAAA
TTAGTTGCTGAAAAACAGCAATAAATGAAAGCCAACGAACAAAAGAGGTAAGAATTACTA
GATGTGTCAAAATTATATGATTTAACTCCATAGTAAACAGCAGAAAAAGTAAAAAATAAG
CAGTAAACACCTATAAAGCAAGAGGAATCGCCTATTAAAACTATTCAATAAGTTATAAAT
ACAAATAAATAAGGTCCATAAAAGCATATAATAAATAGTATAGTTAACAGCGATAACAAA
AATATGATTCCGATTGGAACTATTGCAAATTAAAATAATTCTATTTCTAATCCTTAAACT
TCATATGCACAAAGACAAGCTGAAAATTTGCATATTTCTATTTCACAAAATGGAAATACA
GAAGAAAGCGAACAAACATTAAACTAAATTTCTCAAAACTAAGCAGAATTTAAAAAACTT
TAACTAGAATTTAAAAATTCTGTGAATAAAATAAAGGAGACACCTAAGCAATAGCTTATA
TAAACTCCAATAAGCCTTTTATAAAAATCCAATCTAAAGCTGGATTAAAGTTAGCCAAAT
GAAAATAAAGAAAATTGTATTATCTCAACTCCCATCACTAATAATTAAAATGGAGATCAA
ACTCCTACTGGTGATTAAAAAATAGAATTCAAAAGTACTGTGAATTAATTCAGGAAATCC
TTCTAAAAAAATATGTATTAAACTCCTTAAAACTCAAAAAAGAAATTTTAAAAGAAAGTC
TATGAAAACGAAGATGAGTACTAAGGTAGCATGGAAAATGATATTCCTAATGGCTACGGC
ATTCTTAGAGATAAAAATGGAAAAGAACTCTACAAAGGAGACTGGAAAAACGGATAATAT
GATGGAAGTGGTATATTGGTAAATAGAAATCAAAACGATAGTTAAGCAATTGTGATTGAT
CATAATGAGCTTTCATAAATATTAACCTTAAACTTATGGATTAGATATGAAGGTGATATG
AAACAAAACTAAATATAAGGCTTTGGAACTATGTATTTTATAGATAATTTAAAATACGTT
GGAAATTTTGCTTAAGGTATTCCTGAAGGCTAAGGCTCTTTTTACACAAATGATGGAAAA
GTTATTGCTGGAGTATGGGAATAAGGAAAATTGAAAGATATTCTCTGGGATTGA


>TTHERM_00377350(protein)
MNFVSPQIVQQTPKLQIQGGFPLGRVVSPFQSPYLQQNPIPQAGGFVSQPYQIHPQIQSG
VSSPMMRSNLSVFQQGQIPQQNRTSNSQADLGQYLRSPQSTQKQENQLQRYQNTEPIKKQ
IASNQHFISPQYIQQQTNTGQYIQSNQTQKIQRQTSFHQQQLQNSRLTMQSLPANNNTIN
ITSATSPNERLLSRNLSPQPSHRLNSLLSSPIQRAISPQTQRINKDSFNGTVQTANQNQL
VTQQGPYMLGVAQTLYTPSSRAQSPTFNQNQGFMFTGRNNFVQSPQQTFYSSGQNFYKTN
SMPQQQQQQFIPFKLELPQKVQDNQQKLNEAIAKSEKVKKLVAEKQQQMKANEQKRQELL
DVSKLYDLTPQQTAEKVKNKQQTPIKQEESPIKTIQQVINTNKQGPQKHIINSIVNSDNK
NMIPIGTIANQNNSISNPQTSYAQRQAENLHISISQNGNTEESEQTLNQISQNQAEFKKL
QLEFKNSVNKIKETPKQQLIQTPISLLQKSNLKLDQSQPNENKENCIISTPITNNQNGDQ
TPTGDQKIEFKSTVNQFRKSFQKNMYQTPQNSKKKFQKKVYENEDEYQGSMENDIPNGYG
ILRDKNGKELYKGDWKNGQYDGSGILVNRNQNDSQAIVIDHNELSQILTLNLWIRYEGDM
KQNQIQGFGTMYFIDNLKYVGNFAQGIPEGQGSFYTNDGKVIAGVWEQGKLKDILWD