Identifiers and Description

Gene Model Identifier

TTHERM_00378970

Standard Name

RPN6 (26S proteasome regulatory subunit N6)

Aliases

PreTt10351 | 40.m00236

Description

RPN6 26S proteasome non-ATPase regulatory subunit

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00079.1 9.997093137033517e-262
Description: hypothetical protein (1129 aa)
DictyBase DDB_G0281315 9.997751616309157e-110
Description: psmD11 on chromosome: 3 position 4153223 to 4155157
Oxytricha Contig22448.0.g40 1.000434858898539e-105
Description: PCI domain
SGD YDL097C 3.999498296699862e-96
Description: RPN6 Essential, non-ATPase regulatory subunit of the 26S proteasome lid required for the assembly and activity of the 26S proteasome; the human homolog (S9 protein) partially rescues Rpn6p depletion
WormBase WBGene00004462 1.9998521972819316e-89
Description: locus:rpn-6.1 Probable 26S proteasome regulatory subunit rpn-6.1 status:Confirmed UniProt:Q20938 protein_id:CCD70320.1
Stentor Coeruleus SteCoe_1998 3.817497188671175e-54
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21637855: Xiong J, Yuan D, Fillingham JS, Garg J, Lu X, Chang Y, Liu Y, Fu C, Pearlman RE, Miao W (2011) Gene network landscape of the ciliate Tetrahymena thermophila. PloS one 6(5):e20124

Sequences

>TTHERM_00378970(coding)
ATGACTAGTGTTTTAGACAGATTAGAATAGGAAGCAAATGCCTTAAAGTCTTCTCAAGCT
CCTTAAGTTTATGAAAATGCCCTTTATAAAATTATTGAAGAAGATGTAAAGGAAACAGAT
GATAACTTTAGAATTAAGGAAAATGCTTTTTATAACTTAGTAGAACATTTCAAGTCCTTG
AACCAACCCGTGAAGATTAAAGATTTGATTTATAACAGAATCAATGACATTAATGCATTC
CCTAAGGCAAAAGCAGCAAAAGTTATTAGAACTATTATTGAAGTTGTAGCTACTATTGAA
AAAACTGAAGATATATAAATTGAATTATGCAATTTCTTAGTAGAATGGTGCCAAAAGCAA
GGAATCACTTACTTACGTCACAGAATCGAAATTAAGTTATCAGTCTTATATCTCTAAAGA
GGTGACTATACCAAAGCATTGACAATTATAGAGGCTATCTTAAAAGAAACTCGTAAAGCT
GATGATAAGCATATGCTTGTTGAAGGTCAATTAATCGAGTCTAAAATTCATTATGCACTT
GAAAATTATGCCAAAGCCAAGGCTTCTTTGACTGCTTCAAGAGCTTGCTCAAATTCAATT
TATTGTGCTCCTGCTTTATAAGCTGATATAGATATGATGACAGGTATCTTACAATGTGAA
GATAAAGATTATAAGACAGCATATTCCTATTTCTATGAAGGATTCGAAGCTCTCAATTCC
TTAGATGACCCTAGATCTATTAAGGCCTTGAAATATATGCTTCTTTGTAAAATTATGACA
TCCAACTATGATGATATTGCTTAGATTTTAAATGGAAAGTATGGATTAAAGTATGCAGGA
AAAGACTTGGATGCCATGAAATTAGTTGCTAAGGCCTACAGAGAAAAATCTCTATCATAA
TTCTAAGCCCTCTTACAAACATATGCAGAATAAATCACAGGTGATCCTATCATCAAAAAC
TAATTAAATTAACTTTATGATCAACTACTTGAATAGAATTTATTCAGACTTATTGAACCT
TACACCAGAGTTTAAATTACTCACATAGCTCAAAGAATTGGTCTTGATGAAAATTTGATT
TAAAAGAAATTATCAGAGTTGATTCTTGATAAGAAAATTGATGGTACTTTAGACTAAGGT
ACTGGATGTTTGATTCTCTTTGACGATATTAAATGCGATGATTTATACAAGAATGCTGTC
GAGCACAATCAACAAATGGAAAAGGTTGTTGAAAAGCTATTTGAAAAGGCTAAACTCTTA
AAAAATTGA


>TTHERM_00378970(gene)
ATGACTAGTGTTTTAGACAGATTAGAATAGGAAGCAAATGCCTTAAAGTCTTCTCAAGCT
CCTTAAGTTTATGAAAATGCCCTTTATAAAATTATTGAAGAAGGTATGTTTTTATTTATT
TTTAATTTATCATAATAACAAATACTTATTTATGCATAATCAATCAATATTCTCAAAATA
ATTTCTCTATCTAAAAACCATTTCAGCTTTTTAAAAGTATTTTATACATGCTTTTTTTAT
AATTAGATGTAAAGGAAACAGATGATAACTTTAGAATTAAGGAAAATGCTTTTTATAACT
TAGTAGAACATTTCAAGTCCTTGAAGTATATACAATTTTTTTAATTAATCTTTGATTTGA
TCTATTTATTTTTTGAAAACTTGTCAGCATATTTGAAATGCTCTTATACTATTAACTATG
AATCAATCAAATTATCAAATGTAGCCAATAGTCAACAAAAATATATCTTCATAGTATCCA
AGCCTATTTGATTTGAAATATTTATTTAAATTTAAGCTAAAATATCTTATAAAATTTTAA
AATAAATCTAGCCAACCCGTGAAGATTAAAGATTTGATTTATAACAGAATCAATGACATT
AATGCATTCCCTAAGGCAAAAGCAGCAAAAGTTATTAGAACTATTATTGAAGTTGTAGCT
ACTATTGAAAAAACTGAAGATATATAAATTGAATTATGCAATTTCTTAGTAGAATGGTGC
CAAAAGCAAGGAATCACTTACTTACGTCACAGAATCGAAATTAAGTTATCAGTCTTATAT
CTCTAAAGAGGTGACTATACCAAAGCATTGACAATTATAGAGGCTATCTTAAAAGAAACT
CGTAAAGCTGATGATAAGCATATGCTTGTTGAAGGTCAATTAATCGAGTCTAAAATTCAT
TATGCACTTGAAAATTATGCCAAAGCCAAGGTAAATAAATAGCATATAAATTAACAAATA
AATAAATAAATAAATAAATAAAAACTTGATTCTTTTGTATGAAAGTAATTAATTGAAAAG
TCAAAATCTTAAAATCTTGATTTTTTGAATCCTAGAAACTAGGATATTTTAAAAAAATTA
ATAAATTTAACAAAATATGCAAGGTATTTCTAAAAATAACAAGGATTCCTTTTTTTAAAT
ATTATATAACAACACAAACAAATACACAGAAAGTAAAAGAGTGAGTTAGTTCATAATATT
GAAGATATTATTTTTGAGATGATAAAGCAACTATTTATTCAATATTTAATAATGAAATCA
AATATTGTAAAGAAAAAAAATAATTTTTAGAATTATTAGATGAAAATTTATTAACAAATG
AATGTTTAATTGGGTTATATTTTTTTATTGTGAAGCAAACATAAATTATATTAGAGAACC
GTATGTATTAACTAATAAGCATGTTAAATATAAACGACCAATATTAGGTATATAATCATA
GAGAGTAGATATAATGCATTTAAGAACTAGATATTATTTGTTTTTTGGCAATGGATGACA
AATAAAAATAAATATTTTTGATCCATTTCTATATACCAAATAAATAAAGCTTGCAATTTT
GTATTAATTACTTTTGTTAACTTAATTAGGCTTCTTTGACTGCTTCAAGAGCTTGCTCAA
ATTCAATTTATTGTGCTCCTGCTTTATAAGCTGATATAGATATGATGACAGGTATCTTAC
AATGTGAAGATAAAGATTATAAGACAGCGTATAAAATATTCTATTGAATGAATTTTAGAA
ATTAATTGATTATAAATAAATAAAAATAGATATTCCTATTTCTATGAAGGATTCGAAGCT
CTCAATTCCTTAGATGACCCTAGATCTATTAAGGCCTTGAAATATATGCTTCTTTGTAAA
ATTATGACATCCAACTATGATGATATTGCTTAGATTTTAAATGGAAAGTATGGATTAAAG
TATGCAGGAAAAGACTTGGATGCCATGAAATTAGTTGCTAAGGCCTACAGAGAAAAATCT
CTATCATAATTCTAAGCCCTCTTACAAACATATGCAGAATGTATAAAAATTTATTTATTT
ATTTGAAGCTAGATACAATATTTTTCTTATAAATGATTAATTAGAAATCACAGGTGATCC
TATCATCAAAAACTAATTAAATTAACTTTATGATCAACTACTTGAATAGAATTTATTCAG
ACTTATTGAACCTTACACCAGAGTTTAAATTACTCACATAGCTCAAAGAATTGGTCTTGA
TGAAAATTTGATTTAAAAGAAGTAATAAAACATACAAGTAATAATAAATCATTTAATAAT
TTTATTAATTAAATATTTAGATTATCAGAGTTGATTCTTGATAAGAAAATTGATGGTACT
TTAGACTAAGGTACTGGATGTTTGATTCTCTTTGACGATATTAAATGCGATGTAAATATA
TTTCTAATTAATTAAAAGATTTATAAGAAACATTATTTAGATAAAGAAAAAAATATTTAA
TATTAAATAGGATTTATACAAGAATGCTGTCGAGCACAATCAACAAATGGAAAAGGTTGT
TGAAAAGCTATTTGAAAAGGCTAAACTCTTAAAAAATTGA


>TTHERM_00378970(protein)
MTSVLDRLEQEANALKSSQAPQVYENALYKIIEEDVKETDDNFRIKENAFYNLVEHFKSL
NQPVKIKDLIYNRINDINAFPKAKAAKVIRTIIEVVATIEKTEDIQIELCNFLVEWCQKQ
GITYLRHRIEIKLSVLYLQRGDYTKALTIIEAILKETRKADDKHMLVEGQLIESKIHYAL
ENYAKAKASLTASRACSNSIYCAPALQADIDMMTGILQCEDKDYKTAYSYFYEGFEALNS
LDDPRSIKALKYMLLCKIMTSNYDDIAQILNGKYGLKYAGKDLDAMKLVAKAYREKSLSQ
FQALLQTYAEQITGDPIIKNQLNQLYDQLLEQNLFRLIEPYTRVQITHIAQRIGLDENLI
QKKLSELILDKKIDGTLDQGTGCLILFDDIKCDDLYKNAVEHNQQMEKVVEKLFEKAKLL
KN