Identifiers and Description

Gene Model Identifier

TTHERM_00382150

Standard Name

SQS1 (SQualene Synthase 1)

Aliases

PreTt10372 | 40.m00257

Description

SQS1 squalene/phytoene synthase; Putative squalene and phytoene synthase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF00494 ) Squalene and phytoene synthases
  • ( TIGR01559 ) farnesyl-diphosphate farnesyltransferase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00055.1 9.997093137033517e-262
Description: squalene and phytoene synthase family protein (334 aa)
SGD YHR190W 0.0000000000019997478866288316
Description: ERG9 Farnesyl-diphosphate farnesyl transferase (squalene synthase), joins two farnesyl pyrophosphate moieties to form squalene in the sterol biosynthesis pathway
DictyBase DDB_G0292072 0.000000000040005666873964816
Description: fdfT on chromosome: 6 position 1153510 to 1154993

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00382150(coding)
ATGGCTAGCGTTCAAAAATACACCAAGAGTCCTATGGATATATTGAAAGAAACATCACGT
ACATTCTATATTCCTATTGTCAAGCTTGTTCAAGGAGTCTAAGAGGCTGTTGCTTCTGCT
TACTTGTGCCTCCGTGCTATCGATGAAATCGAAGACCACCCCAATATCCCTAATGAAGTT
AAGGCTCGTATGCTCCGTGAAGTTTCCTTAGTTTGCACTACTTATTCCGCAGAATCTACA
GCTGAATCTCTTACTCCTACTTATGATAATGAAAAGGAATACCGTGATCGTCTTCCTGAA
GTCTCTGCTCGTATTGGAGAATGGATAATGTACTCACCTGCTTCCATCCGTGGTCGTATT
GTTGATGCTACCTCTGGCATGGCTGACAGAATGGCTACCTGGGCTGAACGCAACTGGAAA
TGCGAAACTGAAAGAGATTTAGATGCATACACCTTTGCAGTAGCAGGAGCAGTTGGTTTA
TTGCTTAGCGACATCTGGGCTTGGTGGGATGGCACTAAAACTGATAGAGATCTCGCTATA
GGATTTGGTAGAGGTTTACAAAGCGTTAACATCTTGAGAAATAAGGACGAAGACGCTGAA
CGTGGAGTAACTTTCTATCCCAAGGGCTGGACTGTTGATGACATGCAAGCTTATGCTTAA
AGAAATCTTTAATTTGCTACTAAATACATAAAAGACTTAAAGCCTGGCTCTCCAGCTTTG
ATATTCTGTAGAATTCCTTACAATTTAGCTGTAGCTACTTGCAATACCTTAAAGAGTGGC
AAGGAAAAACTTTCTCGTGAAGAAGTCGTAAAAATTTGCGAAAAAACCGAATTAATTCCT
ACTAACAGCAATGATGGTGCTTCCAAGTAAATTTCTTTGAACGAATTAGATAATGAAAGC
AACAGCACTACTTCCGAAGATAAATCTCCTAAAAACAATTCAAGCATCGAAATAAATTAA
AAAGAATTACCCTAAACCTTAGAACAAGCTGCTTAGTGA


>TTHERM_00382150(gene)
ATGGCTAGCGTTCAAAAATACACCAAGAGTCCTATGGATATATTGAAAGAAACATCACGT
ACATTCTATATTCCTATTGTCAAGCTTGTTCAAGGAGTCTAAGAGGCTGTTGCTTCTGCT
TACTTGTGCCTCCGTGCTATCGATGAAATCGAAGACCACCCCAATATCCCTAATGAAGTT
AAGGCTCGTATGCTCCGTGAAGTTTCCTTAGTTTGCACTACTTATTCCGCAGAATCTACA
GCTGAATCTCTTACTCCTACTTATGATAATGAAAAGGAATACCGTGATCGTCTTCCTGAA
GTCTCTGCTCGTATTGGAGAATGGATAATGTACTCACCTGCTTCCATCCGTGGTCGTATT
GTTGATGCTACCTCTGGCATGGCTGACAGAATGGCTACCTGGGCTGAACGCAACTGGAAA
TGCGAAACTGAAAGAGATTTAGATGCATACACCTTTGCAGTAGCAGGAGCAGTTGGTTTA
TTGCTTAGCGACATCTGGGCTTGGTGGGATGGCACTAAAACTGATAGAGATCTCGCTATA
GGATTTGGTAGAGGTTTACAAAGCGTTAACATCTTGAGAAATAAGGACGAAGACGCTGAA
CGTGGAGTAACTTTCTATCCCAAGGGCTGGACTGTTGATGACATGCAAGCTTATGCTTAA
AGAAATCTTTAATTTGCTACTAAATACATAAAAGACTTAAAGCCTGGCTCTCCAGCTTTG
ATATTCTGTAGAATTCCTTACAATTTAGCTGTAGCTACTTGCAATACCTTAAAGAGTGGC
AAGGAAAAACTTTCTCGTGAAGAAGTCGTAAAAATTTGCGAAAAAACCGAATTAATTCCT
ACTAACAGCAATGATGGTGCTTCCAAGTAAATTTCTTTGAACGAATTAGATAATGAAAGC
AACAGCACTACTTCCGAAGATAAATCTCCTAAAAACAATTCAAGCATCGAAATAAATTAA
AAAGAATTACCCTAAACCTTAGAACAAGCTGCTTAGTGA


>TTHERM_00382150(protein)
MASVQKYTKSPMDILKETSRTFYIPIVKLVQGVQEAVASAYLCLRAIDEIEDHPNIPNEV
KARMLREVSLVCTTYSAESTAESLTPTYDNEKEYRDRLPEVSARIGEWIMYSPASIRGRI
VDATSGMADRMATWAERNWKCETERDLDAYTFAVAGAVGLLLSDIWAWWDGTKTDRDLAI
GFGRGLQSVNILRNKDEDAERGVTFYPKGWTVDDMQAYAQRNLQFATKYIKDLKPGSPAL
IFCRIPYNLAVATCNTLKSGKEKLSREEVVKICEKTELIPTNSNDGASKQISLNELDNES
NSTTSEDKSPKNNSSIEINQKELPQTLEQAAQ