Identifiers and Description

Gene Model Identifier

TTHERM_00384910

Standard Name

CEN1 (CENtrin 1 )

Aliases

centrin | PreTt24783 | 41.m00190

Description

CEN1 basal body centrin protein; Centrin; EF Hand Ca2+ binding protein; alters MT sliding velocity to regulate ciliary beat form; localizes to basal bodies- oral apparatus cortical fibers- ciliary rootlets- the apical filament ring- and axonemal 14S inner arm dynein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

  • ( SD03272 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::CEN1
  • ( SD03273 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-22
  • ( SD03274 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-29
  • ( SD03275 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-49
  • ( SD03276 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-58
  • ( SD03277 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-60
  • ( SD03278 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-86
  • ( SD03279 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-94
  • ( SD03280 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-103
  • ( SD03281 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-126
  • ( SD03282 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-134
  • ( SD03283 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-C-term∆
  • ( SD03284 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF1
  • ( SD03285 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF2
  • ( SD03286 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF1-EF2
  • ( SD03287 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF3
  • ( SD03288 ) Micronucleus: cen1-1[∆::NEO2] Macronucleus: cen1-1[∆::NEO2]::cen1-EF3
  • ( SD03289 ) Micronucleus: cen1-1[∆::NEO2]
  • ( SD03290 ) Micronucleus: cen1-1[∆::NEO2]

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04411.1 9.004285235721242e-114
Description: EF hand family protein (168 aa)
Oxytricha Contig13931.0.g32 9.999030951775615e-88
Description: EF hand
SGD YOR257W 6.997794455893953e-54
Description: CDC31 Calcium-binding component of the spindle pole body (SPB) half-bridge, required for SPB duplication in mitosis and meiosis II; homolog of mammalian centrin; binds multiubiquitinated proteins and is involved in proteasomal protein degradation
WormBase WBGene00000552 2.0008536325002377e-42
Description: locus:cmd-1 Calmodulin status:Confirmed UniProt:O16305 protein_id:CCD69969.1
DictyBase DDB_G0279407 4.001118334825066e-42
Description: calA on chromosome: 3 position 2244074 to 2245039
Stentor Coeruleus SteCoe_19772 2.2273635617957438e-39
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21562224: Vonderfecht T, Stemm-Wolf AJ, Hendershott M, Giddings TH, Meehl JB, Winey M (2011) The two domains of centrin have distinct basal body functions in Tetrahymena. Molecular biology of the cell 22(13):2221-34
  2. Ref:17785518: Kilburn CL, Pearson CG, Romijn EP, Meehl JB, Giddings TH, Culver BP, Yates JR, Winey M (2007) New Tetrahymena basal body protein components identify basal body domain structure. The Journal of cell biology 178(6):905-12
  3. Ref:15944224: Stemm-Wolf AJ, Morgan G, Giddings TH, White EA, Marchione R, McDonald HB, Winey M (2005) Basal body duplication and maintenance require one member of the Tetrahymena thermophila centrin gene family. Molecular biology of the cell 16(8):3606-19
  4. Ref:16228897: Libusová L, Sulimenko T, Sulimenko V, Janisch R, Hozák P, Dráber P (2005) Distinct localization of a beta-tubulin epitope in the Tetrahymena thermophila and Paramecium caudatum cortex. Protoplasma 225(3-4):157-67
  5. Ref:15134263: McLaughlin NB, Buhse HE (2004) Localization by indirect immunofluorescence of tetrin, actin, and centrin to the oral apparatus and buccal cavity of the macrostomal form of Tetrahymena vorax. The Journal of eukaryotic microbiology 51(2):253-7
  6. Ref:12529441: Guerra C, Wada Y, Leick V, Bell A, Satir P (2003) Cloning, localization, and axonemal function of Tetrahymena centrin. Molecular biology of the cell 14(1):251-61
  7. Ref:12356864: Shang Y, Li B, Gorovsky MA (2002) Tetrahymena thermophila contains a conventional gamma-tubulin that is differentially required for the maintenance of different microtubule-organizing centers. The Journal of cell biology 158(7):1195-206

Sequences

>TTHERM_00384910(coding)
ATGTCCCTCAAGAACACTAGACCCCCTGTTAAGTCCACCAGAGTCTCTCGTCCTCAATTG
ACTGAAGAATAAAAATAAGAAATTAAGGAAGCCTTCGATCTTTTCGATACCGATGGCACT
GGATATATTGATGCCAAGGAACTTAAGGTAGCAATGAGAGCTTTAGGATTTGAACCTAAA
AAGGAAGAAATCAAGAAAATGATTGCTGAAATCGACAGAGAAGGTCGTGGAGTTATTGAA
TTCTAAGACTTCCTTGATCTCATGACCGTTAAAATGGCTGAAAGAGATCCCAGAGATGAA
ATTTTAAAAGCTTTTAGATTATTTGATGATGATAATACTGGTAAGATCTCCTTAAAGAAT
TTAAAAAGAGTTGCCAGAGAATTGGGTGAAGCTATGACTGAAGAAGAACTCTAAGAAATG
ATTGATGAAGCTGATAGAGATGGTGATGGTGAAATTAGTGAGGAAGAATTCGTTAGAATT
ATGAAAAAGACCAACCTCTTCTGA


>TTHERM_00384910(gene)
ATGTCCCTCAAGAACACTAGACCCCCTGTTAAGTCCACCAGAGTCTCTCGTCCTCAATTG
ACTGAAGAATAAAAATAAGAAATTAAGGAAGCCTTCGATCTTTTCGATACCGATGGCACT
GGATATATTGATGCCAAGGAACTTAAGGTAGCAATGAGAGCTTTAGGATTTGAACCTAAA
AAGGAAGAAATCAAGAAAATGATTGCTGAAATCGACAGAGAAGGTCGTGGAGTTATTGAA
TTCTAAGACTTCCTTGATCTCATGACCGTTAAAATGGTAACTAAAATTTCTTTATTTTAA
TAAATAAGCAGACAGACATACTCATGAACTAGCATTAATAATTTGAATTTAAATAAAATA
GGCTGAAAGAGATCCCAGAGATGAAATTTTAAAAGCTTTTAGATTATTTGATGATGATAA
TACTGGTAAGATCTCCTTAAAGAATTTAAAAAGAGTTGCCAGAGAATTGGGTGAAGCTAT
GACTGAAGAAGAACTCTAAGAAATGATTGATGAAGCTGATAGAGATGGTGATGGTGAAAT
TAGTGAGGAAGAATTCGTTAGAATTATGAAAAAGACCAACCTCTTCTGA


>TTHERM_00384910(protein)
MSLKNTRPPVKSTRVSRPQLTEEQKQEIKEAFDLFDTDGTGYIDAKELKVAMRALGFEPK
KEEIKKMIAEIDREGRGVIEFQDFLDLMTVKMAERDPRDEILKAFRLFDDDNTGKISLKN
LKRVARELGEAMTEEELQEMIDEADRDGDGEISEEEFVRIMKKTNLF