Identifiers and Description

Gene Model Identifier

TTHERM_00388620

Standard Name

KDF1 (KinetoDesmal Fiber 1)

Aliases

PreTt24857 | 41.m00264

Description

normocyte-binding protein putative; Kinetodesmal fiber protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02172 ) KIX domain
  • ( PF02189 ) Immunoreceptor tyrosine-based activation motif
  • ( PF06705 ) SF-assemblin/beta giardin
  • ( PF08518 ) Spa2 homology domain (SHD) of

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04491.1 3.0005183738819142e-162
Description: hypothetical protein (263 aa)
Oxytricha Contig1313.1.g99 4.0009493637353324e-18
Description: SF-assemblin/beta giardin

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:21127172: Gould SB, Kraft LG, van Dooren GG, Goodman CD, Ford KL, Cassin AM, Bacic A, McFadden GI, Waller RF (2011) Ciliate pellicular proteome identifies novel protein families with characteristic repeat motifs that are common to alveolates. Molecular biology and evolution 28(3):1319-31

Sequences

>TTHERM_00388620(coding)
ATGAATAACTCAGGATATATCTCAAACAGCACTCAAATCACTAACTAGAGCTAAATAGAT
CGTGTTTAAAAGGTTTTCGATCGTATCAACAATATCCAAAACAGTATCGAAGGTGAAAAG
CAAAGCAGATTTACTGTTATTACTCAACTCATATTATAATTCGAGCAAACTCTTAACGAA
TTAAGCGCCCGTAAAGAAGAAAAATTTGAAAATTTAGCTGAAAAACTCCGCAAGTTGGAA
GAAGCTATTGTTGAAGAATCTGAGAAATCTGAGACATAAGATAATGATTCTCAACGTGAA
TTAATTAACTTAGAAAAAAATTGCAAGCGTCTTCTTGAACTTAATAGCAAGGAGCGTGTT
GAAAGTGAAAAGAAGCTTGCTCAGCGCATTGCTTAGCAATTCGAAGCTCTCACTGTCGAT
ATTAATAAAGAAGCTTAAGCTTAAATGACATCTCATGGCTACCTTGATACCTACCTTAAT
GAGGATCTCCCTCGTTTGAAGGATGAATTAAGCTATGAAATTTAATAACGTCAAGAAGTT
GAACAAAAAATTCATAGTCAATTTATGGATAGAATTTCTGAACTAAAGGAGATATTTGAA
CGTGAACGCAAGGAAAGAGAAATTAAGGAAGAATAGCTTGTTGTTTTCCTTAAAGAGCTC
TCTCACCGCACATAAGACAACCTTGTCCGTATTAAAAGAGATAGAGAAAGAAATGAAGAA
TAAATTGTTACCTTAATTGAAAGTGTTATTGAAAAATTGAAGAAAGAAATGGTTGAGCTC
GAATTGTGA


>TTHERM_00388620(gene)
ATGAATAACTCAGGATATATCTCAAACAGCACTCAAATCACTAACTAGAGCTAAATAGAT
CGTGTTTAAAAGGTTTTCGATCGTATCAACAATATCCAAAACAGTATCGAAGGTGAAAAG
CAAAGCAGATTTACTGTTATTACTCAACTCATATTATAATTCGAGCAAACTCTTAACGAA
TTAAGCGCCCGTAAAGAAGAAAAATTTGAAAATTTAGCTGAAAAACTCCGCAAGTTGGAA
GAAGCTATTGTTGAAGAATCTGAGAAATCTGAGACATAAGATAATGATTCTCAACGTGAA
TTAATTAACTTAGAAAAAAATTGCAAGCGTCTTCTTGAACTTAATAGCAAGGAGCGTGTT
GAAAGTGAAAAGAAGCTTGCTCAGCGCATTGCTTAGCAATTCGAAGCTCTCACTGTCGAT
ATTAATAAAGAAGCTTAAGCTTAAATGACATCTCATGGCTACCTTGATACCTACCTTAAT
GAGGATCTCCCTCGTTTGAAGGATGAATTAAGCTATGAAATTTAATAACGTCAAGAAGTT
GAACAAAAAATTCATAGTCAATTTATGGATAGAATTTCTGAACTAAAGGAGATATTTGAA
CGTGAACGCAAGGAAAGAGAAATTAAGGAAGAATAGCTTGTTGTTTTCCTTAAAGAGCTC
TCTCACCGCACATAAGACAACCTTGTCCGTATTAAAAGAGATAGAGAAAGAAATGAAGAA
TAAATTGTTACCTTAATTGAAAGTGTTATTGAAAAATTGAAGAAAGAAATGGTTGAGCTC
GAATTGTGA


>TTHERM_00388620(protein)
MNNSGYISNSTQITNQSQIDRVQKVFDRINNIQNSIEGEKQSRFTVITQLILQFEQTLNE
LSARKEEKFENLAEKLRKLEEAIVEESEKSETQDNDSQRELINLEKNCKRLLELNSKERV
ESEKKLAQRIAQQFEALTVDINKEAQAQMTSHGYLDTYLNEDLPRLKDELSYEIQQRQEV
EQKIHSQFMDRISELKEIFERERKEREIKEEQLVVFLKELSHRTQDNLVRIKRDRERNEE
QIVTLIESVIEKLKKEMVELEL