Identifiers and Description

Gene Model Identifier

TTHERM_00389830

Standard Name

TAD1 (tRNA-specific adenosine deaminase 1)

Aliases

PreTt24879 | 41.m00286

Description

TAD1 tRNA-specific adenosine deaminase putative; tRNA-specific adenosine deaminase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF02137 ) Adenosine-deaminase (editase) domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04514.1 9.997093137033517e-262
Description: adenosine deaminase (420 aa)
DictyBase DDB_G0278943 2.0004286606204839e-16
Description: DDB_G0278943 on chromosome: 3 position 1240717 to 1242542
SGD YGL243W 0.0000000000019997478866288316
Description: TAD1 tRNA-specific adenosine deaminase, deaminates adenosine-37 to inosine in tRNA-Ala
WormBase WBGene00000080 0.00000000006996681903814525
Description: locus:adr-2 Probable double-stranded RNA-specific adenosine deaminase status:Confirmed UniProt:Q22618 protein_id:CCD73351.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00389830(coding)
ATGCATTACATAGAGTAATTAAATCTACTGAATCCCATAATTAAAGAGTGCTTGAGCAGT
AAGCAAAAGAATGGCAAGATAATTAAGATAAAATGGAAATAGAAAGTGCCTCTATACAAA
ATACCTAAAAACAATAAAAAAAGCTACATAGAGGAGCTCTTCTCCCGAGTGGAAGCCATT
TAAATTGGAAAGATTAAATAAATGAAATTCTCAAATGATAATAAAAAATTTTTTTAATTG
TATGAAACCTACCATCCATAATACTATATTAAATGTATATAATAACTATAAAAATTTCCT
TTAATTGATATAAATAAATCTTTGATTCAAAAAAGTTTACAATTTAATAAATCTTAAATA
CTAAACGAGTTTTTATTCAATATATATTTTCTGTAGCAAATGGTAGACATAAAATTACTA
AAACAAATACTTTAAGCAATACACGATAAGTTTAATAGCGTATTTTAAAAGGTTTTGAAA
AAAGATATATCAGATGCTCAAGAGCAGACTGTATTAGCTAGTATAGTGTTGATATTACAA
TAAACATAGACATTTGAAATTATTTCTATAGCAAATGGTACAAAATCTATTGGTAAGAAA
AATATGTCAGAGCTAGGCAATTTAGTTAATGACTCCCATGCTGAAATTCTAGCAAGAAGA
GCTTTTAAAAAATTTCTCTATGATAATCTAAATAATCCTAAATACTTTTAAATTAATGAT
AATAATAAATATGTTTAAAAGTTTAAAGTTTTATTTTATACGAGCTAAACTCCTTGCGGA
TAGGCTTCAATATTTCAAAATTTAAATGGCAACATACTACCAAGTGTTTCTAATTGTATC
TAGGATTAAGTAATTAATAGTTCAAATAATGAAACCTAAACTCCTGAGCAGAAATAAAAA
TTCTTTTAAAACACAGGAGCTAAATACTACAGCTTCTTGTACGATGAAAAATATCAAGTA
GAAAAAGATTAACAAAATAATATACTTAGAATAAAACCAGGAAGAAGTGATTTACCTTAA
GATTCAAGAAGTTAAAGCTTGAGTTGTAGTGATAAGATAATGATATGGAATGTTATTGGT
TTACAAGGAAGTTTACTTTCTGAGCTATTAGACAGACCAATCTATATTGATTACTTTTTT
ATTGAAAGTGATGGTAATGACTTGAAGGAATTTAAGCAAAAAGTAAGACAAGGTATTAAT
CTTGAAACTAGATTAAACGAGTAGTTTACAAATAAACGTCTAAAAGAAAATGTTTTGAAA
TGGAGAAAAAAACCTATTAGCAAGAATTACTTCTTTAAAAATCCTCCAATAATTGTAACA
AAAAAATATTTTTTTAAGCTTAATAGAAATCTTAGCTAAAATAAGCCAAAATATTTGGAT
TAGCATATAGTCTATTTAAGCGAATATATTGATAATAATGGTGAAAAGAAAGTAGAATTT
ACTGAAATTTTAAATGGTAGCAGTGGCTTAAAATGGGGAATGGGTGAAAAAGGATCACAA
ATCCCAAAAAATTACCCTGCACTATGTAAATATAACTTGTATAAAGCATATTGCCAAATA
AAACATATGAGTAGTAAGAAAAGCTATTTAGTAAACAAAGAATAATCTATTAAATATAAT
CTAATTAAAAGGTAACTGCTAAAGTTGTTTAAGGAAAATATAGTCGATAAAAAAAGATAC
GATAATTTTTGTATTGCTGAATAATAATGA


>TTHERM_00389830(gene)
ATGCATTACATAGAGTAATTAAATCTACTGAATCCCATAATTAAAGAGTGCTTGAGCAGT
AAGCAAAAGAATGGCAAGATAATTAAGATAAAATGGAAATAGAAAGTGCCTCTATACAAA
ATACCTAAAAACAATAAAAAAAGCTACATAGAGGAGCTCTTCTCCCGAGTGGAAGCCATT
TAAATTGGAAAGATTAAATAAATGAAATTCTCAAATGATAATAAAAAATTTTTTTAATTG
TATGAAACCTACCATCCATAATACTATATTAAATGTATATAATAACTATAAAAATTTCCT
TTAATTGATATAAATAAATCTTTGATTCAAAAAAGTTTACAATTTAATAAATCTTAAATA
CTAAACGAGTTTTTATTCAATATATATTTTCTGTAGCAAATGGTAGACATAAAATTACTA
AAACAAATACTTTAAGCAATACACGATAAGTTTAATAGCGTATTTTAAAAGGTTTTGAAA
AAAGATATATCAGATGCTCAAGAGCAGACTGTATTAGCTAGTATAGTGTTGATATTACAA
TAAACATAGACATTTGAAATTATTTCTATAGCAAATGGTACAAAATCTATTGGTAAGAAA
AATATGTCAGAGCTAGGCAATTTAGTTAATGACTCCCATGCTGAAATTCTAGCAAGAAGA
GCTTTTAAAAAATTTCTCTATGATAATCTAAATAATCCTAAATACTTTTAAATTAATGAT
AATAATAAATATGTTTAAAAGTTTAAAGTTTTATTTTATACGAGCTAAACTCCTTGCGGA
TAGGCTTCAATATTTCAAAATTTAAATGGCAACATACTACCAAGTGTTTCTAATTGTATC
TAGGATTAAGTAATTAATAGTTCAAATAATGAAACCTAAACTCCTGAGCAGAAATAAAAA
TTCTTTTAAAACACAGGAGCTAAATACTACAGCTTCTTGTACGATGAAAAATATCAAGTA
GAAAAAGATTAACAAAATAATATACTTAGAATAAAACCAGGAAGAAGTGATTTACCTTAA
GATTCAAGAAGTTAAAGCTTGAGTTGTAGTGATAAGATAATGATATGGAATGTTATTGGT
TTACAAGGAAGTTTACTTTCTGAGCTATTAGACAGACCAATCTATATTGATTACTTTTTT
ATTGAAAGTGATGGTAATGACTTGAAGGAATTTAAGCAAAAAGTAAGACAAGGTATTAAT
CTTGAAACTAGATTAAACGAGTAGTTTACAAATAAACGTCTAAAAGAAAATGTTTTGAAA
TGGAGAAAAAAACCTATTAGCAAGAATTACTTCTTTAAAAATCCTCCAATAATTGTAACA
AAAAAATATTTTTTTAAGCTTAATAGAAATCTTAGCTAAAATAAGCCAAAATATTTGGAT
TAGCATATAGTCTATTTAAGCGAATATATTGATAATAATGGTGAAAAGAAAGTAGAATTT
ACTGAAATTTTAAATGGTAGCAGTGGCTTAAAATGGGGAATGGGTGAAAAAGGATCACAA
ATCCCAAAAAATTACCCTGCACTATGTAAATATAACTTGTATAAAGCATATTGCCAAATA
AAACATATGAGTAGTAAGAAAAGCTATTTAGTAAACAAAGAATAATCTATTAAATATAAT
CTAATTAAAAGGTAACTGCTAAAGTTGTTTAAGGAAAATATAGTCGATAAAAAAAGATAC
GATAATTTTTGTATTGCTGAATAATAATGA


>TTHERM_00389830(protein)
MHYIEQLNLLNPIIKECLSSKQKNGKIIKIKWKQKVPLYKIPKNNKKSYIEELFSRVEAI
QIGKIKQMKFSNDNKKFFQLYETYHPQYYIKCIQQLQKFPLIDINKSLIQKSLQFNKSQI
LNEFLFNIYFLQQMVDIKLLKQILQAIHDKFNSVFQKVLKKDISDAQEQTVLASIVLILQ
QTQTFEIISIANGTKSIGKKNMSELGNLVNDSHAEILARRAFKKFLYDNLNNPKYFQIND
NNKYVQKFKVLFYTSQTPCGQASIFQNLNGNILPSVSNCIQDQVINSSNNETQTPEQKQK
FFQNTGAKYYSFLYDEKYQVEKDQQNNILRIKPGRSDLPQDSRSQSLSCSDKIMIWNVIG
LQGSLLSELLDRPIYIDYFFIESDGNDLKEFKQKVRQGINLETRLNEQFTNKRLKENVLK
WRKKPISKNYFFKNPPIIVTKKYFFKLNRNLSQNKPKYLDQHIVYLSEYIDNNGEKKVEF
TEILNGSSGLKWGMGEKGSQIPKNYPALCKYNLYKAYCQIKHMSSKKSYLVNKEQSIKYN
LIKRQLLKLFKENIVDKKRYDNFCIAEQQ