Identifiers and Description

Gene Model Identifier

TTHERM_00391430

Standard Name

MRNC02 (Membrane Occupation and Recognition Nexus protein C-terminal)

Aliases

PreTt23470 | 42.m00204 | 3813.m01431

Description

MORN motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11457.1 9.997093137033517e-262
Description: hypothetical protein (502 aa)
Oxytricha Contig20078.0.g13 0.00000000039982266684865623
Description: MORN repeat

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00391430(coding)
ATGTCAGCATCAGCAGTTTTAAAAGCAAATGATTTTATGATTCCTTATGAGACCATAAGA
TCGAAATATGAAAATTAAGGAGTTTTAGGTGTTGGTTTTGATTGGGTACTCGAATTAACT
TCAACAAATTATGTTTTAGTTGAACCAAAATCCTCTTATAAGATAATCATGCAACATTAT
TAGTCATTAGCCCCAGAAGTTTACAAGCTTAAAATTGAAAGAATAACTGAAGCAGCAGCT
TCCAGTTACAATTCTCACCTGTAGAAGATTATTGGCTTTTCAATGCAAGAGAGAAAAGGA
GGAGAGAAGGATTTATATGTTTTGTATGATTATAATGAAGTTGCTAGTAATTTTGAAAGC
TACATCTAAGAATAGAGATCTGGAGATGGTATTTAAGAAGAAGAAGTTTATGAATTGATA
TATACATGTCTTGATAGCTTTTATCTCTCTTGTCTTAATCATATGGAATATCTCACACTA
AATCCCTACAATATCTTTGTATCACGCTCTCAATATCAGAAATTTATAATAGGTAATTGC
AGCTTAACGATTGCAGGCAAAGAAAAAGCTTTAGATTTTAGTCTTCCAACAGATAATTTT
CATAGCATAAAGCCTTTAAGCAGAGATGCAAACTGCACAGAAAGAGCTCTTTTGTTTAAA
GTGGGCATGCTCGTATTGTATATGATTGGAACATAAGATTTAGTCACATTCCATAACGAA
TTCAAAAGCAAAATCTCTACTTAATCAATATAATTTTATCTCTAACACGCAGGTTAGGTA
TACTCAGCTCAATTGATTTCTCTTTTAAATGACATGCTTTTCTTAAATGAAGCTATTCGC
CCTACCCTCAAATCTATTATTGAAATGAAAAGCGACAAGTACTTCCCTCGTCCTCTTAAA
TACTATTAAGGAACAATTATGAATAATGCATTTGAATTCAAAGGCTGGGTTGAGTGGTAT
AATGATCCAACTTCAGGGGAGCTAAAAAAGCATATGACTGGTTTAGGTTAAGTTGTAGGA
GTCTTTAACGGTCATTTTGTCTAAACAAGAAAGTATGGATATGGCCTAAGTATGCAACCA
AACGGTATCCATACATGGGGAAATTGGGAAAATGATGCTATTTCTCACGGTATTCTTTAC
AATACAGTTTAAAGATATATTTTCATTGGAGAGTTCAAAGATGAATAATTATCTAATGCC
TCTGGTTCTCTTATTTACTTGAGAGACAGCACTAATCAAGGAGGAGTTTTAGCCTATGAA
GGAGAATTTATAGATGGAAAAATTGTAAGTGGAGAGTGCTGGACACTAGAAGGTAAATAC
TAAGGTAACTTTTAGGATGGGCTATTTGAGGGTGATGGTGTATTTATATTTAGATATCCT
AAATCTGGTTACAGAATTTGGGAAGGACCTTTCCACTAAGGAAAGTTTAATGGTCAAGGT
GTTCTTAAAAAGACAGATGGATAAGAAATATAAGCTAGATTTAACATGGGATAGAGAGTT
GATAGTTAATGA


>TTHERM_00391430(gene)
ATGTCAGCATCAGCAGTTTTAAAAGCAAATGATTTTATGATTCCTTATGAGACCATAAGA
TCGAAATATGAAAATTAAGGAGTTTTAGGTGTTGGTTTTGATTGGGTACTCGAATTAACT
TCAACAAATTATGTTTTAGTTGAACCAAAATCCTCTTATAAGATAATCATGCAACATTAT
TAGTCATTAGCCCCAGAAGTTTACAAGGTAAAATGGCAACAAATTTAAAGTTTAAACATC
ATTCAATACTATTATATCTTACAATATTTTGATTAAATCGATAATCTAAAAAGTAGGATT
TTTTACGAATTTTATTTTAAAAAAATCAAAATAGCTTAAAATTGAAAGAATAACTGAAGC
AGCAGCTTCCAGTTACAATTCTCACCTGTAGAAGATTATTGGCTTTTCAATGCAAGAGAG
AAAAGGAGGAGAGAAGGATTTATATGTTTTGTATGATTATAATGAAGTTGCTAGTAATTT
TGAAAGCTACATCTAAGAATAGAGATCTGGAGATGGTATTTAAGAAGAAGAAGTTTATGA
ATTGATATATACATGTCTTGATAGCTTTTATCTCTCTTGTCTTAATCATATGGAATATCT
CACACTAAATCCCTACAATATCTTTGTATCACGCTCTCAATATCAGAAATTTATAATAGG
TAAATTAATTAATCATTTTATCCAAAATTATTTATTTAAAATTTTAAAAAATCATCAAAA
AAATCTTTAATTTAATACTTTAATTCAATTTGTTTGTAATAATAATGTTATAAAAGGTAA
TTGCAGCTTAACGATTGCAGGCAAAGAAAAAGCTTTAGATTTTAGTCTTCCAACAGATAA
TTTTCATAGCATAAAGCCTTTAAGCAGAGATGCAAACTGCACAGAAAGAGCTCTTTTGTT
TAAAGTGGGCATGCTCGTATTGTATATGATTGGAACATAAGATTTAGTCACATTCCATAA
CGAATTCAAAAGCAAAATCTCTACTTAATCAATATAATTTTATCTCTAACACGCAGGTTA
GGTATACTCAGCTCAATTGATTTCTCTTTTAAATGACATGCTTTTCTTAAATGAAGCTAT
TCGCCCTACCCTCAAATCTATTATTGAAATGAAAAGCGACAAGTACTTCCCTCGTCCTCT
TAAATACTATTAAGGAACAATTATGAATAATGCATTTGAATTCAAAGGCTGGGTTGAGTG
GTATAATGATCCAACTTCAGGGGAGCTAAAAAAGCATATGACTGGTTTAGGTTAAGTTGT
AGGAGTCTTTAACGGTCATTTTGTCTAAACAAGAAAGTATGGATATGGCCTAAGTATGCA
ACCAAACGGTATCCATACATGGGGAAATTGGGAAAATGATGCTATTTCTCACGGTATTCT
TTACAATACAGTTTAAAGGTAAATATTACTTACTTTAATTTATATAATATAAAATTAATC
AATATTTAGATATATTTTCATTGGAGAGTTCAAAGATGAATAATTATCTAATGCCTCTGG
TTCTCTTATTTACTTGAGAGACAGCACTAATCAAGGAGGAGTTTTAGCCTATGAAGGAGA
ATTTATAGATGGAAAAATTGTAAGTGGAGAGTGCTGGACACTAGAAGGTAAATACTAAGG
TAACTTTTAGGATGGGCTATTTGAGGGTGATGGTGTATTTATATTTAGATATCCTAAATC
TGGTTACAGAATTTGGGAAGGACCTTTCCACTAAGGAAAGTTTAATGGTCAAGGTGTTCT
TAAAAAGACAGATGGATAAGAAATATAAGCTAGATTTAACATGGGATAGAGAGTTGATAG
TTAATGA


>TTHERM_00391430(protein)
MSASAVLKANDFMIPYETIRSKYENQGVLGVGFDWVLELTSTNYVLVEPKSSYKIIMQHY
QSLAPEVYKLKIERITEAAASSYNSHLQKIIGFSMQERKGGEKDLYVLYDYNEVASNFES
YIQEQRSGDGIQEEEVYELIYTCLDSFYLSCLNHMEYLTLNPYNIFVSRSQYQKFIIGNC
SLTIAGKEKALDFSLPTDNFHSIKPLSRDANCTERALLFKVGMLVLYMIGTQDLVTFHNE
FKSKISTQSIQFYLQHAGQVYSAQLISLLNDMLFLNEAIRPTLKSIIEMKSDKYFPRPLK
YYQGTIMNNAFEFKGWVEWYNDPTSGELKKHMTGLGQVVGVFNGHFVQTRKYGYGLSMQP
NGIHTWGNWENDAISHGILYNTVQRYIFIGEFKDEQLSNASGSLIYLRDSTNQGGVLAYE
GEFIDGKIVSGECWTLEGKYQGNFQDGLFEGDGVFIFRYPKSGYRIWEGPFHQGKFNGQG
VLKKTDGQEIQARFNMGQRVDSQ