Identifiers and Description

Gene Model Identifier

TTHERM_00392950

Standard Name

DRH44 (DExD/H box RNA helicase 44)

Aliases

PreTt23523 | 42.m00257 | 3813.m01478

Description

DRH44 DEAD/DEAH-box helicase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11497.1 9.997093137033517e-262
Description: helicase domain-containing protein (458 aa)
Oxytricha Contig526.1.g121 9.998720540547892e-23
Description: DEAD/DEAH box helicase
DictyBase DDB_G0291804 9.000561397357242e-21
Description: ddx6 on chromosome: 6 position 773358 to 774746
SGD YDL084W 1.9991095569230066e-20
Description: SUB2 Component of the TREX complex required for nuclear mRNA export; member of the DEAD-box RNA helicase superfamily and is involved in early and late steps of spliceosome assembly; homolog of the human splicing factor hUAP56
WormBase WBGene00010260 5.999654353873483e-20
Description: locus:ddx-17 status:Confirmed UniProt:Q9XUW5 protein_id:CAB04518.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00392950(coding)
ATGAGCGATTAAGTAGAAGAAAAAAAAGATAACTAATCAGTAAATACAGTCATGACTGAA
GATATTAAGAAAGAGCATTTAAGAAGCATTGAGACAGATAAAACTTGGGATGATATTTTT
GCTTTGTCTCCTGAAGTGAGAGAAAGAATTAAACAAATTTACGAAAGGCCTACGAAGATT
TAATATTTGTCTATTGGAGAAACAATTGAATATATATAGCCAGTTATTACAATCAAGTGC
AGAAATGGTGGAGGTAAAACTCTTACTTTTGCTATTCCTGCTTTGGAATTTGCTTACAGA
AATAAAAATAAAAAGACTTCAAAATCCTAGCAATCAGTCTAAGAAGTTCATGGATAGAGT
TCCTAAACTGGAGCAACTGTTTACTGTCCTACATCGATTATTATTGTGTCAACATAGCCA
CTCGCTTTGCAAATTTAAAGCGTTTTAAATAATCTTTTGGTTGAAGGAGTTTCTACAGAA
GTTCTATTCTAAGACCAAAAGATTACTCAATCTGGTTAGATATTGATTTCCACTCCAGAG
CTACTTTACAGATACTTGGTGATAGAAAAGTTAATATAGTTAGATAATTTATGTCATATT
GCTGTTGATGAAGCTGATAATATGCTCACATCATTTTAGATGCAATTAGAAAGAACAATC
GTATTTTTAAAGGGTAGAGATATTGTCATTTAGTTTGTTTCTGCTACCTTGACAGAAAAA
AATATTAAATTTATTTATGATGCTTTAAAATTTGATAGCACTTAAGACGAAGATTCTAAA
ATTTTGTATTCAATTGAGTTACCTTGGAAATTAAAAGGTGTTACTTAATATGGATAAGTG
TTAAAAGGAAATAAATAGGAGAATGATATAGAAAAGTATATGATTTGCACTCAATTAGTC
AATTAAGTAATTGAATATAACTCCAAGAACCCTGATTTGGAATCTTAAATTATAATCTTC
TTTAGAAAGATAGCAAGCATTTTAGAATTTGAAAGTAAGATTGCTAGAGAAAAGTTAAAT
TGGAAATATACAACTTGTGCTAATAAAAGTAAAAGAAATGAAAATATATAAAATTTCCGT
GCTGGAAACTATGACATTATGTTAGCCACTAGTGTTATGAGTAGAGGTATTGATATTCGT
AAAGTAGGTTTAGTTATTAACTTTGACATGCCCTTAGAAATGAATGAAAAACTGGAATAC
CTAGATAAACATCAATATTTGCACAATATTGGTAGAACTGGTAGATTTGCAGATTTAGGT
CTATCATTAACTTTCTTCGAAAATGATAAGGTATACGAAAATGCCAAGTATACGATTAAG
GATAGTTTTGAATGCGATTTACTTGACTTCAAAATGGAAAATATGATTCCTGAGTTGGCT
AGTGTTATGAAAAATAACACACAACATCAAAGAGTGCAGTGA


>TTHERM_00392950(gene)
ATGAGCGATTAAGTAGAAGAAAAAAAAGATAACTAATCAGTAAATACAGTCATGACTGAA
GATATTAAGAAAGAGCATTTAAGAAGCATTGAGACAGATAAAACTTGGGATGATATTTTT
GCTTTGTCTCCTGAAGTGAGAGAAAGAATTAAACAAATTTACGAAAGGCCTACGAAGATT
TAATATTTGTCTATTGGAGAAACAATTGAATATATATAGCCAGTTATTACAATCAAGTGC
AGAAATGGTGGAGGTAAAACTCTTACTTTTGCTATTCCTGCTTTGGAATTTGCTTACAGA
AATAAAAATAAAAAGACTTCAAAATCCTAGCAATCAGTCTAAGAAGTTCATGGATAGAGT
TCCTAAACTGGAGCAACTGTTTACTGTCCTACATCGATTATTATTGTGTCAACATAGCCA
CTCGCTTTGCAAATTTAAAGCGTTTTAAATAATCTTTTGGTTGAAGTAAATACTCATCGA
AGTTGATAGTTTCTTTAATATTAATTTTATTAAAATTTTTAATAGGGAGTTTCTACAGAA
GTTCTATTCTAAGACCAAAAGATTACTCAATCTGGTTAGATATTGATTTCCACTCCAGAG
CTACTTTACAGATACTTGGTGATAGAAAAGTTAATATAGTTAGATAATTTATGTCATATT
GCTGTTGATGAAGCTGATAATATGCTCACATCATTTTAGATGCAATTAGAAAGAACAATC
GTATTTTTAAAGGGTAGAGATATTGTCATTTAGTTTGTTTCTGCTACCTTGACAGAAAAA
AATATTAAATTTATTTATGATGCTTTAAAATTTGATAGCACTTAAGACGAAGATTCTAAA
ATTTTGTATTCAATTGAGTTACCTTGGAAATTAAAAGGTGTTACTTAATATGGATAAGTG
TTAAAAGGAAATAAATAGGAGAATGATATAGAAAAGTATATGATTTGCACTCAATTAGTC
AATTAAGTAATTGAATATAACTCCAAGAACCCTGATTTGGAATCTTAAATTATAATCTTC
TTTAGAAAGATAGCAAGCATTTTAGAATTTGAAAGTAAGATTGCTAGAGAAAAGTTAAAT
TGGAAATATACAACTTGTGCTAATAAAAGTAAAAGAAATGAAAATATATAAAATTTCCGT
GCTGGAAACTATGACATTATGTTAGCCACTAGTGTTATGAGTAGAGGTATTGATATTCGT
AAAGTAGGTTTAGTTATTAACTTTGACATGCCCTTAGAAATGAATGAAAAACTGGAATAC
CTAGATAAACATCAATATTTGCACAATATTGGTAGAACTGGTAGATTTGCAGATTTAGGT
CTATCATTAACTTTCTTCGAAAATGATAAGGTATACGAAAATGCCAAGTATACGATTAAG
GATAGTTTTGAATGCGATTTACTTGACTTCAAAATGGAAAATATGATTCCTGAGTTGGCT
AGTGTTATGAAAAATAACACACAACATCAAAGAGTGCAGTGA


>TTHERM_00392950(protein)
MSDQVEEKKDNQSVNTVMTEDIKKEHLRSIETDKTWDDIFALSPEVRERIKQIYERPTKI
QYLSIGETIEYIQPVITIKCRNGGGKTLTFAIPALEFAYRNKNKKTSKSQQSVQEVHGQS
SQTGATVYCPTSIIIVSTQPLALQIQSVLNNLLVEGVSTEVLFQDQKITQSGQILISTPE
LLYRYLVIEKLIQLDNLCHIAVDEADNMLTSFQMQLERTIVFLKGRDIVIQFVSATLTEK
NIKFIYDALKFDSTQDEDSKILYSIELPWKLKGVTQYGQVLKGNKQENDIEKYMICTQLV
NQVIEYNSKNPDLESQIIIFFRKIASILEFESKIAREKLNWKYTTCANKSKRNENIQNFR
AGNYDIMLATSVMSRGIDIRKVGLVINFDMPLEMNEKLEYLDKHQYLHNIGRTGRFADLG
LSLTFFENDKVYENAKYTIKDSFECDLLDFKMENMIPELASVMKNNTQHQRVQ