Identifiers and Description

Gene Model Identifier

TTHERM_00392980

Standard Name

SAP30

Aliases

PreTt23526 | 42.m00260 | 3813.m01482

Description

histone deacetylase complex subunit SAP30 Sin3-binding protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11500.1 6.000481660141652e-51
Description: hypothetical protein (96 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:34086947: Nabeel-Shah S, Garg J, Saettone A, Ashraf K, Lee H, Wahab S, Ahmed N, Fine J, Derynck J, Pu S, Ponce M, Marcon E, Zhang Z, Greenblatt JF, Pearlman RE, Lambert JP, Fillingham J (2021) Functional characterization of RebL1 highlights the evolutionary conservation of oncogenic activities of the RBBP4/7 orthologue in Tetrahymena thermophila. Nucleic acids research ( ):

Sequences

>TTHERM_00392980(coding)
ATGAGCAAAAGCAATCAACCATAAGAAGACTTAGAAGAATAATACCTTCCAGATTTTACT
AAATTATCAAATGCCTCATTGCAAAAATACAGAATGTATTACAATATAGAATGTACTGAA
GAAGAGCTTGTAGAGAAAGTTAAAAAACACTTCAAATCCACCCTAGACATAAATTCGCTT
TAGTTATATGAAAAGATATTCAAGTTGAAAAGAGAAGAAAGAGAAGAATTAAAAAACAGG
AAGACTTTAAGAACAAAGAAAGAAATCTAAAAATCTAATTTTTGA


>TTHERM_00392980(gene)
ATGAGCAAAAGCAATCAACCATAAGAAGACTTAGAAGAATAATACCTTCCAGATTTTACT
AAATTATCAAATGCCTCATTGCAAAAATACAGAGTAAGTTTATTGTTTTGTGATTATACT
ATCATCGCAAATTTGTAAAGTGGTGGTGACATATTTATTAAGCTTCATTTTTAATAACAA
TTTAGATGTATTACAATATAGAATGTACTGAAGAAGAGCTTGTAGAGAAAGTTAAAAAAC
ACTTCAAATCCACCCTAGACATAAATTCGCTTTAGTTATATGAAAAGATATTCAAGTTGA
AAAGAGAAGAAAGAGAAGAATTAAAAAAGTAAGTTTTTAATAGTAAGTATGAAGGTTTAA
TATTTATTATTCTATATTTTAATTTAACAGCAGGAAGACTTTAAGAACAAAGAAAGAAAT
CTAAAAATCTAATTTTTGA


>TTHERM_00392980(protein)
MSKSNQPQEDLEEQYLPDFTKLSNASLQKYRMYYNIECTEEELVEKVKKHFKSTLDINSL
QLYEKIFKLKREEREELKNRKTLRTKKEIQKSNF