Identifiers and Description

Gene Model Identifier

TTHERM_00395710

Standard Name

THD5 (Tetrahymena Histone Deacetylase 5)

Aliases

PreTt23595 | 42.m00329 | 3813.m01547

Description

THD5 histone deacetylase family protein; Histone deacetylase family protein; suppresses DNA transcription by deacetylation of histones; localizes to macronucleus

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11546.1 9.997093137033517e-262
Description: histone deacetylase (682 aa)
Oxytricha Contig549.1.g14 1.9999366565375063e-113
Description: Histone deacetylase domain
WormBase WBGene00007953 3.000074895537278e-78
Description: locus:hda-11 status:Partially_confirmed UniProt:Q18477 protein_id:CAA94910.3
Stentor Coeruleus SteCoe_25228 6.813556821545298e-46
Description: None
SGD YNL021W 2.9992476920535046e-16
Description: HDA1 Putative catalytic subunit of a class II histone deacetylase complex that also contains Hda2p and Hda3p; Hda1p interacts with the Hda2p-Hda3p subcomplex to form an active tetramer; deletion increases histone H2B, H3 and H4 acetylation
DictyBase DDB_G0268024 9.997764199084386e-16
Description: hdaA on chromosome: 1 position 1320084 to 1322172

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:18178773: Smith JJ, Torigoe SE, Maxson J, Fish LC, Wiley EA (2008) A class II histone deacetylase acts on newly synthesized histones in Tetrahymena. Eukaryotic cell 7(3):471-82

Sequences

>TTHERM_00395710(coding)
ATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTTTTATTACAGGG
TTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACATCCTCATCCCA
TTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAATAGAAAAGGAG
AAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAATATATTGAAAAT
TTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTGAAAAACTTCAC
CCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAAAAGGATTTCTA
TAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAATGCTGCATTTA
GGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTATCCAAATGTATA
GAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTATTAGATCCTATG
ATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAAGAGGCTGGTCT
ATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAATCTGGAGGCGGATTTTGCATA
TATCCAGACATATGTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGC
ATGATTGTAGATTTAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGAT
AAAGAAAATACATTTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTT
GCAGCCAAAGGTATAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATAT
ATCTCTATGTTGAGAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTA
CTATATAATGCAGGAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCT
CAAAATTGCATAATTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATA
CCCTTAACTATGGTGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGAC
TCTATTTTAAATCTTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAA
AACCCATGA


>TTHERM_00395710(gene)
ATGTACACACTAATTTGCGCTGTTTAAGATTTAGCTTTATTTGGAATTTTTATTACAGGG
TTGGTCTTATTAGAATGGCAAATAATTGTATTTCCCATTTTAATTTACATCCTCATCCCA
TTTTTAAACGAGTTGGTCTACAATTGCTTTGCTAAATTATTATTCACAATAGAAAAGGAG
AAGAAAAGGATGGAGTAAAGGTATTCTTAATCAGAATTAGAAAATAAATATATTGAAAAT
TTACCTATTTTATACCATCCCTCATACAACATTACAGCTTGTGGGATTGAAAAACTTCAC
CCTTTTGATTCTGTAAAGTATGGAAGAGTTTTTAATATACTCAAAGAAAAAGGATTTCTA
TAAGAATAAGGTTTCTATAAGCCAAAAGAAAAAGTAGGAAGAGGCTTAATGCTGCATTTA
GGAATGTCTCCTTTGTATTTACTTTATCTTAATTATGCTGCTTATGTATCCAAATGTATA
GAAATTCCTCTATTCTTCCTACCTGCCAGCTTCTTAAGATGGAAAGTATTAGATCCTATG
ATGTTTTCTACTCAGGGTTCAATAGATGCCGCCGTTTTATCTTTAAAAAGAGGCTGGTCT
ATAAATTTAAGTGGAGGCTATCACCACGCTTGCAGGTAAACTAAAAGTTTATAAAAAATA
TTAACATACTATTACAAATTTTTGAATAAAATAACAAAATTACATCTAATTATTATGTTT
TTTAACTAAAAATAAATTTCATTTCTGCATCTTTTAACAATTTAAACATCTAAGATACTC
TGAAAAGCAGAAAGTTGCCCTAGAAAATTAAAAAATTTACTCAAAATTTTAAATAAATAA
TTTCAGTAGTGAATTAAGAAACCAATAAAAGCCTAATCAGTATTTATCAATAAAATTATA
AACATCTAATAAAATCTAACATAGCATCAATAGGAATAAAAAGTAACTAGTATAGAAATG
ATTAAATTATAGAGTAAATTTTAAAAAAATAATATAGAAGTATAAAACAGGATTTAATTA
TTAATACAACATTCACCCAATTTATCATCTCCAAAAAATAGTTATTTATTTATTTAATTT
TGATTAGAATAAGTTTTGAAATTCTTTTTTCTTTTATTTAATTTAAATTCGATGTTTATC
GTTTCATTTTATTAAAATTTAGGTAATCTGGAGGCGGATTTTGCATATATCCAGACATAT
GTTTCGCTATAGAATATTTAAGAAAATGTTTTGGCATAAAAAGATGCATGATTGTAGATT
TAGATGCTCATCAAGGAAATGGACATGAAAGAGATTTTATAGATGATAAAGAAAATACAT
TTATATTAGATTTTTACAATCACAGTATTTATCCAGCAGATACCTTTGCAGCCAAAGGTA
TAAGTCTTTCTAAAAACGTAGATTTTGATACATCTGATTCAGAATATATCTCTATGTTGA
GAAAGACACTTTAAAAAATTCTTGATTAATTCAAACCTGAGTTTTTACTATATAATGCAG
GAACTGATTGTCTTGAAGGTGATCGTTTGGGTTAAATGAATCTCTCTCAAAATTGCATAA
TTCAGAGAGATTAAGTTGTATTTGAAGAATGCTTAAATAGAGATATACCCTTAACTATGG
TGCTTTCAGGAGGGTATTAGTAAATAAATGCACCTGTTATAGCTGACTCTATTTTAAATC
TTGATTAAAATTTAAAAATAAAAAATTACAATAGAAAAAAATTATAAAACCCATGA


>TTHERM_00395710(protein)
MYTLICAVQDLALFGIFITGLVLLEWQIIVFPILIYILIPFLNELVYNCFAKLLFTIEKE
KKRMEQRYSQSELENKYIENLPILYHPSYNITACGIEKLHPFDSVKYGRVFNILKEKGFL
QEQGFYKPKEKVGRGLMLHLGMSPLYLLYLNYAAYVSKCIEIPLFFLPASFLRWKVLDPM
MFSTQGSIDAAVLSLKRGWSINLSGGYHHACRQSGGGFCIYPDICFAIEYLRKCFGIKRC
MIVDLDAHQGNGHERDFIDDKENTFILDFYNHSIYPADTFAAKGISLSKNVDFDTSDSEY
ISMLRKTLQKILDQFKPEFLLYNAGTDCLEGDRLGQMNLSQNCIIQRDQVVFEECLNRDI
PLTMVLSGGYQQINAPVIADSILNLDQNLKIKNYNRKKLQNP