Identifiers and Description

Gene Model Identifier

TTHERM_00399550

Standard Name

RRM14 (RNA Recognition Motif-containing protein 14)

Aliases

PreTt12698 | 43.m00216 | 3713.m00045

Description

RRM14 RNA recognition motif protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00076 ) RNA recognition motif. (a.k.a. RRM,

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_14001.1 2.9986068920536807e-84
Description: hypothetical protein (252 aa)
Oxytricha Contig16564.0.g25 5.002171138422328e-22
Description: RNA recognition motif_ (a_k_a_ RRM, RBD, or RNP domain)
WormBase WBGene00004698 0.000000100009565553302
Description: locus:rsp-1 Probable splicing factor, arginine/serine-rich 1 status:Confirmed UniProt:Q23121 protein_id:CAA91395.1
SGD YNL016W 0.00000019998969434520019
Description: PUB1 Poly (A)+ RNA-binding protein, abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly
DictyBase DDB_G0280393 0.000006997203421143941
Description: DDB_G0280393 on chromosome: 3 position 3254509 to 3256772

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00399550(coding)
ATGAGCTAGTTTAGTTTATTTGTAGGGAATGTTTCAAAGAATGTAGATTAAAAACGTTTA
GAGAAAGAGTTCTCTAAGTTTGGCGAATGCACTGTCGATTTGAGAAGAAAGTACGCATTT
GTCTCTTTTAAAGAAGTCAGAGATGCAGAAGATGCCAAAAAGTAGATGCATAAAAAAGAT
TTAGGAGGTTTATTGATAACTGTTGAATGGTCTAAGTAATCAGGAAGGTTTGAAGAAAAT
AGCAGCGGAAGATTTAGAGGAAGAAGAAGAAGTTCATCAAGAGATAGAAGTAGAAGAAGA
AAAAGATACTCTAGATCAAGATCTTCACGCAGCCATTCATCAGATAGAAAAACTTCAAGA
AGAAGAGATAGAAGCAGAAGTGGAAGTAGAAGAAGAACTAGAAGAAGCAGCAGAAGTGAT
AGTCGAAAAAACAGTAGAAAGAGAGATGAAAAAAAAACTAATGGGTCTGATAGAAGAAGA
AAAAGATCTGAGTCCTCAAAGAAAAAAAAATCCTCTAGAGATGACAGAAGTCCTAAGAAA
GATAGCTCTAGCAAAGATAAGAAGTCAGAAAATGGAAAAAGAAAAGACTCTAGTCTATCT
CCTAAAAAATAAATCAGCTCAGAAAATAAATCTGAATTAAAAGATTAAGACATTGAAAAC
AAAGAAAGCACTCAAATTGAGGAATAGACTCAATCTCAATAATAGTAACAACAATAAGAA
GAAATTATCAATGAGTGA


>TTHERM_00399550(gene)
ATGAGCTAGTTTAGTTTATTTGTAGGGAATGTTTCAAAGAATGTAGATTAAAAACGTTTA
GAGAAAGAGTTCTCTAAGTTTGGCGAATGCACTGTCGATTTGAGAGTAAATAGAATCATT
TTATTAACAAATTTAGCAATAAACTGAAGATTTTTATTTAAAAATTTTTAAACTTTCAAT
AAAGTGACCCATAAATCAACTACTGCACAAGCAATCAATAAAATACCATCATCTTATTTT
ATTGATCTTGTAATAATCTAAATAAATCATACATACATACATAATTGCTAACTTCTGAAA
TTTGAAGCTAAGCACTTTTCAATTTTTCTAAGATTATCTTTGCAGCAGTTCGGAACAAAT
ATTCCTGCCTAGCGATGACTGACCTTCGGGTAGCTTTTCAATAATATCCTCCCATTCTTT
ATTGCCATCTCCTATATTTAGAGTCAGGCACTTCAAATAATATATCTCATCGCCAGCAGA
ATTACCCAAAAATATGATTAATAAAAAATCATAAATTGAATTCTGCTTAGATTGCTTTGC
TTTATAATTCTCCTTAAAATGAGAGTATCTATCCAACAACCACCCACACACCCTTCCTAC
CATCTACCAACCCACCAATCGATTCAACCAATCATCAATAATTTTCTATGCTAAGAGAAA
CATTTGGGTCATGAAAAATCAACAACATCATCATCAACATACCAAGCAACAAGCATCTAT
CTACCCATCCATCCATCCACCCACCCATTCAACCAACATGTTCATATTCCCCTAGATTAA
ATACCACCCAAACAGCAAAACAATAAGCTTACCATAATGTAGTAAAATCAACAAAAAATT
TCTTTTAATTTAAAATCATCATTGTTGAGAGAAAGAAAGCATAATATATAATATAAATTT
TTCAATAAGCAAAACTATTTATATAATATTTAATATTTTCGATATCCAAAAATAGATGCT
AATAAATAAATTAGCCATATTAATTGCTTACTTAATCAAATGAATTAAAACATGTATTGT
GAAAAAATATTTTTTAAGCAAATTGGATTGATTCATTTTTGCCCTATTTAACTAAAAAAT
TAAAATTAATAAGCAAAATAAATTAAAATATGATAAAATAAGTAGTAATTAATTATATCA
GAAATGGCTATTTTTTATTTATTGATATCATTAAGTAACTTGTTTGATTATAAAAAAGGA
GATATATAAAGCTAATTTATCTATTATTACTTTACTTACAAATAAAATAAAAGGAAAATA
AATAATTTCTCTTCTTTAATTTTACTTTTTATTAATTTTTACTAAATTGCGATTTAGTAA
TAATAAATTCAAATTTAATATTAGAGAAAGTACGCATTTGTCTCTTTTAAAGAAGTCAGA
GATGCAGAAGATGCCAAAAAGTAGATGCATAAAAAAGATTTAGGAGGTAAGAAATTAAAA
ATTTACATCCATAGAAGAAAAAAAAATTTCATGATATAAAATAATAATAATTTTGTAATA
ATTAAACTAATATTTAAGGATTTAAATTAATTATTATTTTATGAGTAATAAATTTATTTA
CTTATTTTAGGTTTATTGATAACTGTTGAATGGTCTAAGTAATCAGGAAGGTTTGAAGAA
AATAGCAGCGGAAGATTTAGAGGAAGGTAAATAAATGAATAATATCAAAACAAAAAAAGT
TAACTTTACATTTTCATTTAAATATTTTAAATAGAAGAAGAAGCTCTCGTTCAAGAAGTA
GGTAAAATAATAACATTGTTTTAAATATTCACACTTGATGTTGAATATTTTTCTATTTAA
TAGAAGAAGAAGTTCATCAAGAGATAGAAGTAGAAGAAGAAAAAGATACTCTAGATCAAG
ATCTTCACGCAGCCATTCATCAGATAGAAAGTTAATAACTAAATAAATAAATAATTTTAA
TTTTCTAAGCATTTTTGATTAATTAAATATTTAATATTTCTTTCTTTATTTCTTTTTAGA
ACTTCAAGAAGAAGAGATAGAAGCAGAAGTGGAAGTAGAAGAAGAACTAGAAGAAGCAGC
AGAAGTGATAGTCGAAAAAACAGTAGAAAGAGAGATGAAAAAAAAACTAATGGGTCTGAT
AGAAGAAGAAAAAGATCTGAGTCCTCAAAGAAAAAAAAATCCTCTAGAGATGACAGAAGT
CCTAAGAAAGATAGCTCTAGCAAAGATAAGAAGTCAGAAAATGGAAAAAGAAAAGACTCT
AGTCTATCTCCTAAAAAATAAATCAGCTCAGAAAATAGTAAAAATTGTATTTATTTGTTG
AAAAAATAATATCTTAAAATATTAACAAATTTAAAAGAATCTGAATTAAAAGATTAAGAC
ATTGAAAACAAAGAAAGCACTCAAATTGAGGAATAGACTCAATCTCAATAATAGTAACAA
CAATAAGAAGAAATTATCAATGAGTGA


>TTHERM_00399550(protein)
MSQFSLFVGNVSKNVDQKRLEKEFSKFGECTVDLRRKYAFVSFKEVRDAEDAKKQMHKKD
LGGLLITVEWSKQSGRFEENSSGRFRGRRRSSSRDRSRRRKRYSRSRSSRSHSSDRKTSR
RRDRSRSGSRRRTRRSSRSDSRKNSRKRDEKKTNGSDRRRKRSESSKKKKSSRDDRSPKK
DSSSKDKKSENGKRKDSSLSPKKQISSENKSELKDQDIENKESTQIEEQTQSQQQQQQQE
EIINE