Identifiers and Description

Gene Model Identifier

TTHERM_00405400

Standard Name

GST10 (Glutathione S-transferase mu 10, TtGSTm10, GSTm10)

Aliases

PreTt12787 | 43.m00305 | 3713.m00128

Description

GST10 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain
  • ( TIGR01001 ) homoserine O-succinyltransferase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04321.1 3.000712232670428e-104
Description: glutathione S-transferase domain-containing protein (209 aa)
Oxytricha Contig16299.0.g15 2.9990241513684e-21
Description: Glutathione S-transferase, N-terminal domain
WormBase WBGene00001767 0.0007999190683310628
Description: locus:gst-19 status:Partially_confirmed UniProt:Q93701 protein_id:CAB02294.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00405400(coding)
ATGTCTTCTTAAACAATCAACTTAGGATTCTGGGCTCTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTAGCTCAATATCCATACTAATAGACTAACTATACTTTAGAAGAA
TCTAAAGAATGGTTCGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGTGATTTTAAGATCACTGAATCTTAAAACATTGTCAATTATGCTTTG
GATGCCACTAAGTAGCATCATTTATTGGGATCTGGACTAATAAGGTTTAAGATAGAAAAT
GTTAGATTCCTTTGTGATGAGTTGACTGCCAAAACATTCTAAGCATCAAGGAAAACAGGA
GAAGAAAAGAATACTGAAATCAACAATACTGTGATTCCTAAATTTAAGTTTTTATCAGTT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGACAAGTTAACTCTAGCAGATATTTTTGCT
TACACAGCAATAAAAACACTGTAACATGTGTTGAATGATGAATACAAGTAATTTGCTTAA
GTTTTCGATCCATTTATGAAAAACTTTGAAGAAATTCCTTAGATTAAGGCTTACCATAGC
TCAGACAGATATCCTAAATTTACATGA


>TTHERM_00405400(gene)
ATGTCTTCTTAAACAATCAACTTAGGATTCTGGGCTCTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTAGCTCAATATCCATACTAATAGACTAACTATACTTTAGAAGAA
TCTAAAGAATGGTTCGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGTGATTTTAAGATCACTGAATCTTAAAACATTGTCAATTATGCTTTG
GATGCCACTAAGTAGCATCATTTATTGGGATCTGGACTAATAAGGTTTAAGATAGAAAAT
GTTAGATTCCTTTGTGATGAGTTGACTGCCAAAACATTCTAAGCATCAAGGAAAACAGGA
GAAGAAAAGAATACTGAAATCAACAATACTGTGATTCCTAAATTTAAGTTTTTATCAGTT
GTTTTAGGAAACAAAAAGTTTTTCTTTGAAGACAAGTTAACTCTAGCAGATATTTTTGCT
TACACAGCAATAAAAACACTGTAACATGTGTTGAATGATGAATACAAGTAATTTGCTTAA
GTTTTCGATCCATTTATGAAAAACTTTGAAGAAATTCCTTAGATTAAGGCTTACCATAGC
TCAGACAGATATCCTAAATTTACATGA


>TTHERM_00405400(protein)
MSSQTINLGFWALPLRAQPIRYIFELAQYPYQQTNYTLEESKEWFEKDKKELGLDFPNLP
YLIHGDFKITESQNIVNYALDATKQHHLLGSGLIRFKIENVRFLCDELTAKTFQASRKTG
EEKNTEINNTVIPKFKFLSVVLGNKKFFFEDKLTLADIFAYTAIKTLQHVLNDEYKQFAQ
VFDPFMKNFEEIPQIKAYHSSDRYPKFT