Identifiers and Description

Gene Model Identifier

TTHERM_00405470

Standard Name

GST9 (Glutathione S-transferase mu 9, TtGSTm9, GSTm9)

Aliases

PreTt12794 | 43.m00312 | 3713.m00134

Description

GST9 glutathione S-transferase amine-terminal domain protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00043 ) Glutathione S-transferase, C-terminal domain
  • ( PF02798 ) Glutathione S-transferase, N-terminal domain

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_04321.1 2.9996910481190226e-100
Description: glutathione S-transferase domain-containing protein (209 aa)
Oxytricha Contig16299.0.g15 3.9992896861436003e-19
Description: Glutathione S-transferase, N-terminal domain
WormBase WBGene00021127 0.000005000363240844623
Description: status:Confirmed UniProt:O45010 protein_id:CCD73396.1
DictyBase DDB_G0268138 0.0004000184047659232
Description: DDB_G0268138 on chromosome: 1 position 1528262 to 1528973

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00405470(coding)
ATGTCTTCATTAACTTTAAATTTAGGATTCTGGGCTCTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTAGCTCAATATCCATACTAATAGACTAACTATACTTTTAAAGAA
TCTAAAGAATGGTTTGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGCGATTTTAAGATCACTGAAACTCAAAACATTATCAATTACGCTTTG
GATATCACTAAATAACAAAATTTATAAGGATATGGACTAACAAGATATAAGGTAGATAAT
GTTAGATTCCTTTGTGATGAGCTGATTGCCAAAATCTTCTTAGCATCAACGAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAACTCTGTTAATCCTAAATTGAAGTATTTATAAGGT
GCTTTAGGAAACAAATAGTTTTTCTTTGAAGACAAGTTAACTTTAGCTGATATCTATGTT
TACACAGCAGTAAATGGATTGTAACATTTGTTGAATGATGAATACAAGTAATTCGTTTAA
ACTTTTGGTCCTTTTATGAAAAACTTTGAAGAAATTCCTTTAATTAAGGCTTACCATAGC
TCAAACAGATACCCTAAATTATCATGA


>TTHERM_00405470(gene)
ATGTCTTCATTAACTTTAAATTTAGGATTCTGGGCTCTTCCATTAAGAGCATAACCTATA
AGATATATTTTTGAACTAGCTCAATATCCATACTAATAGACTAACTATACTTTTAAAGAA
TCTAAAGAATGGTTTGAAAAAGATAAAAAAGAACTTGGTCTAGATTTTCCTAACTTGCCT
TACCTCATACATGGCGATTTTAAGATCACTGAAACTCAAAACATTATCAATTACGCTTTG
GATATCACTAAATAACAAAATTTATAAGGATATGGACTAACAAGATATAAGGTAGATAAT
GTTAGATTCCTTTGTGATGAGCTGATTGCCAAAATCTTCTTAGCATCAACGAAAACAGGA
GAAGAAAAGAAGGCTGAAATCAACAACTCTGTTAATCCTAAATTGAAGTATTTATAAGGT
GCTTTAGGAAACAAATAGTTTTTCTTTGAAGACAAGTTAACTTTAGCTGATATCTATGTT
TACACAGCAGTAAATGGATTGTAACATTTGTTGAATGATGAATACAAGTAATTCGTTTAA
ACTTTTGGTCCTTTTATGAAAAACTTTGAAGAAATTCCTTTAATTAAGGCTTACCATAGC
TCAAACAGATACCCTAAATTATCATGA


>TTHERM_00405470(protein)
MSSLTLNLGFWALPLRAQPIRYIFELAQYPYQQTNYTFKESKEWFEKDKKELGLDFPNLP
YLIHGDFKITETQNIINYALDITKQQNLQGYGLTRYKVDNVRFLCDELIAKIFLASTKTG
EEKKAEINNSVNPKLKYLQGALGNKQFFFEDKLTLADIYVYTAVNGLQHLLNDEYKQFVQ
TFGPFMKNFEEIPLIKAYHSSNRYPKLS