Identifiers and Description

Gene Model Identifier

TTHERM_00410210

Standard Name

SOR2 (Sortilin 2)

Aliases

PreTt21538 | 44.m00205 | 3714.m00052

Description

SOR2 BNR/Asp-box protein; BNR/Asp-box repeat family/ VPS10 domain containing protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

  • ( PF00880 ) Nebulin repeat
  • ( PF02012 ) BNR/Asp-box repeat
  • ( PF05115 ) Cytochrome B6-F complex subunit VI

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10316.1 9.997093137033517e-262
Description: BNR/Asp-box repeat family protein (893 aa)
Oxytricha Contig4955.0.0.g74 3.0011595823640496e-94
Description: BNR/Asp-box repeat
Stentor Coeruleus SteCoe_29949 2.0842828425817514e-52
Description: None
SGD YBL017C 4.000521932330652e-52
Description: PEP1 Type I transmembrane sorting receptor for multiple vacuolar hydrolases; cycles between the late-Golgi and prevacuolar endosome-like compartments
DictyBase DDB_G0290081 4.000352986427571e-28
Description: sort1 on chromosome: 5 position 3627939 to 3630336

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00410210(coding)
ATGAAAATAAAAAGGAATTAGCAAATTGCAATTATATTTGCTATTTTCATCTTGACTGCT
ATTTAGGCAGCAGATGATGTTGCAGATGATAAGGTTTAGTAAGCTATAAAAAGTTATTAA
AAGTAAGTAGATGGAGGTATTTTAGAATTCGAGTGGTGTGGTACAAATGAAATTTATAAC
GATGAAACTGACCGTGTTGTTGTTGATTAAGAAGTTGAAGAATCATTCGATACTCGTATA
TTTGTTCTTACAGATGAAGGTTAAGTTTTTAAAAGTACAAACTATGGTAAAAGTTGGGTC
CATGTCACTAAATCCTTTTATGGTTCAAATAATTAGCCATTTTTCTCTACTGAAGTTTCC
ATTTCTCCTGTTGATGGTAAAACAGTCTATATTTGGGGACACAAGGATACCAGCTATGTT
TCTGAGGAATGTGGTAAGACTTGGAAAAAGTTAAACCATCCTGCTGGTTTGTTTGATTTT
AGATTTCACCGTAAAAATAAAAATTGGGTATTAGCTTTCACTAATATAGAATGTAAGAGA
TTTGATGAAGATTGTGAATCTAATATGAGAAATCTTTACGTTTCTTAAGATGCGGGTGTT
ACTTTCACATTCTTAGCTACTAAAGTTTTAGAAGCTTCATGGAATAGAATGAATAACTTT
TACAACGTTGACAGTCCTGGTATTTTAATGGCCGTTCAATAAGAATCATAAAGTAATGTA
GTTTACACTGAAGACTTCGGTAAAACTATGCACACAGTTTAAGAAGGTGGTGATAATTTC
TTTTAAGCAGAGTACTTCCTCTTTTTAACAGTTAAGCCTAAAAACAGTAAAAGAACCTAT
GATATGAAAATCGCAACTATGTTTGACGATTTTAATTACTATGTTGAACCCAAAAGCTTA
AAGCTTCCCTTTGAAAACACTGATTAACTTTCGTTTACAATTCTAAAGAGCGATGGTGCC
ATGGTTTTCCTTGCCATACACCACGAAACTCAAAATATGTGGTAAAGCAATATCTATGTT
TCTGATTGGAGAGGTTATGATTTGACTTTAGCTTTACTTTACAATGTTAGAGCTCCAAAC
GGAGATTGCGACTTTGAAAAGATAGAAAGCAATGAAGGTGTTTATATAGCAAATACATAT
GATGTTGAAAAAGTTGAAAAATTAAGAAACGAAGTTAAAAAAATGGATATCAGCACTGCA
AAGAATAAATTATAAACAAAAGATAAAAAGAATTTGCACAAAGAACTAACTAATTATAGG
AAATCAGTCATTTCATTTGACAGCGGTTCTAGTTGGCATCCAATTAGAGCTCCTTCATAG
AGATGGAATGGAAAGACTGTTGTTTGCAGTGGAGAATGCAGTTTGCATTTAGCTGGTAGA
ACATATTATAAAAAATCTTAGATGTATTCTTCCTCTAACGCTCCTGGTTTAATTGTTGCA
TTAGGAAGCATTGGAACTCATCTTGAAAACAACTTCAATCTTCTTAACACATATCTTTCA
AACGATGGTGGTCACTAATGGCGTGAAATTCTTAAGGGTCCTCATATTTTTGAAATTGGT
GATCATGGTGGTATCATCGTAGCTGCTTCTGTTGCCAATAAAACAAATATCATCAAATAC
AGTTGGGATGAAGGAAAAACATGGAGCGAATATAAATTGAGTGCTTTACCATTTGAAATA
GATTAAATAATTACTGAGCCTAGCAATATGGAACAGAGATTTGTTGTTTATGGAAAAGGA
AGAAATGGAACAGAAACTTCTATGATTGTTTCTGTAGATTTATAAGATTTGCACATTAGA
GGTTGTGTAGGAGCTGAACATCCTAATAGACCTAATAGTGATTATGAAATCTGGATTCCT
ACTAATTTTAAAGGTGAACAATGTATTTTCGGTCGTAAAGTTAAATATGTTAGAAGAAAG
CCTGATGCAAAATGCTTTAATTCTATCACAACAGATTAAAAAACAGTTATTGAAGAATGC
CCATGCACATAAGAAGATTGGGAATGTGACTTCGGTTTCTACAGAAAAGAAAACGAATTA
GAATGTATTCCAATGAATGAGCATTATTCTCCTGATAATCTTGCTAAACCTCCTGCAGAT
TGTAGTTGGTCTTACTTAGTCTCAAAGGGATATAGAAAAATACCAGGAGTATTTTGTTAA
GGAGGTGTTGATTTAAGTCCAGAATATAAAGAATGTCCTCCAAAAATATCAGTGCCTAGA
ACTGAAGAAGAAACAGATTAATATAAAAGCTTCAAAGAAGCATAAAAAGAGATTATTAGC
TAATATTAATAGTAATAGTAGTAATCAAATAGTTAAAATGGAAAAACTGATTCATCATCT
TCAATAAACTGGGGTGTTATTTTTACATAAATTTTCTATGCTGGATTAATTTTAACAGCT
TTAGCTTTAGCTTTCATATTTAGAGAGAATATCAAATAAGTAGTAAAAAGCATTGGTGAA
ATAGGACATAATAAAGAACGCAAATAATATTAATAACTCTAATCATCTTAGAATAAATAA
TCATCATACACTTAATAGAAAAATACTCAAAATGTCCGCATTTAAGAAACTGAAGAAAGA
AATTATGATTTAGAAGAATAAGACATGCATTATCCAGAAGATGAAAAGCCTGTCTTGTAA
AGAGATCAAGAAGATTACTATTATTAAGAAGATTACGATTGA


>TTHERM_00410210(gene)
ATGAAAATAAAAAGGAATTAGCAAATTGCAATTATATTTGCTATTTTCATCTTGACTGCT
ATTTAGGCAGCAGATGATGTTGCAGATGATAAGGTTTAGTAAGCTATAAAAAGTTATTAA
AAGTAAGTAGATGGAGGTATTTTAGAATTCGAGTGGTGTGGTACAAATGAAATTTATAAC
GATGAAACTGACCGTGTTGTTGTTGATTAAGAAGTTGAAGAATCATTCGATACTCGTATA
TTTGTTCTTACAGATGAAGGTTAAGTTTTTAAAAGTACAAACTATGGTAAAAGTTGGGTC
CATGTCACTAAATCCTTTTATGGTTCAAATGTAAAACCTCATTTTAAATTAGCATTATTT
AATTTTGAATTAACCATTTAATATCAAATTTTAAAAAAAGAATTAGCCATTTTTCTCTAC
TGAAGTTTCCATTTCTCCTGTTGATGGTAAAACAGTCTATATTTGGGGACACAAGGATAC
CAGCTATGTTTCTGAGGAATGTGGTAAGACTTGGAAAAAGTTAAACCATCCTGCTGGTTT
GTTTGATTTTAGATTTCACCGTAAAAATAAAGTAAACAAACAAACAAACAAACAAACTAC
TTAGCTATTGATCTATTTGATTTTTTAAAATGGATTTTCTTTGACTAAAGTTTATTTTTT
TATTTAATAGAATTGGGTATTAGCTTTCACTAATATAGAATGTAAGAGATTTGATGAAGA
TTGTGAATCTAATATGAGAAATCTTTACGTTTCTTAAGATGCGGGTGTTACTTTCACATT
CTTAGCTACTAAAGTTTTAGAAGCTTCATGGTACTAAATATTGTTTGTTTGATAGAGAGT
ATTTTTATAGATTATACTTTAAATATAAATAGGAATAGAATGAATAACTTTTACAACGTT
GACAGTCCTGGTATTTTAATGGCCGTTCAATAAGAATGTAAAACGTTTGAAATTTATAAT
GGAACTCTCAATAATTTTCTTTATTCAAATAAAAATAGCATAAAGTAATGTAGTTTACAC
TGAAGACTTCGGTAAAACTATGCACACAGTTTAAGAAGGTGGTGATAATTTCTTTTAAGC
AGAGTACTTCCTCTTTTTAACAGTTAAGCCTAAAAACAGTAAAAGAACCTATGATATGAA
AATCGCAACTATGTTTGACGATTTTAATTACTATGTTGAACCCAAAAGCTTAAAGCTTCC
CTTTGAAAACACTGATTAACTTTCGTTTACAATTCTAAAGAGCGATGGTGCCATGGTTTT
CCTTGCCATACACCACGAAACTCAAAATATGTGGTAAAGCAATATCTATGTTTCTGATTG
GAGAGGTTATGATTTGACTTTAGCTTTACTTTACAATGTTAGAGCTCCAAACGGAGATTG
CGACTTTGAAAAGGTAAAAAAAAATAATTTATAAAATAAGCTTAATTAATTGTTAGATAT
ATAAAAAAATATAATGACAAAAAAGTAATAGATTGAGAAATAAATAGTGATTGACTTAAA
ATAGATTCTTTCAATTTTTAGAAAATTTTTGTAGGTTAAATCAAAATTTAATAAAATATA
CAAAAAATAAAAATAGATAGAAAGCAATGAAGGTGTTTATATAGCAAATACATATGATGT
TGAAAAAGTTGAAAAATTAAGAAACGAAGTTAAAAAAATGGATATCAGCACTGCAAAGAA
TAAATTATAAACAAAAGATAAAAAGAATTTGCACAAAGAACTAACTAATTATAGGAAATC
AGTCATTTCATTTGACAGCGGTTCTAGTTGGCATCCAATTAGAGCTCCTTCATAGGTAAA
TAAAATTGCATAATATTCCAAATTAATCTATATTTTTAACTTAGAGATGGAATGGAAAGA
CTGTTGTTTGCAGTGGAGAATGCAGTTTGCATTTAGCTGGTAGAACATATTATAAAAAAT
CTTAGATGTATTCTTCCTCTAACGCTCCTGGTTTAATTGTTGCATTAGGAAGCATTGGAA
CTCATCTTGAAAACAACTTCAATCTTCTTAACACATATCTTTCAAACGATGGTGGTCACT
AATGGCGTGAAATTCTTAAGGGTCCTCATATTTTTGAAATTGGTGATCATGGTGGTATCA
TCGTAGCTGCTTCTGGTAATTTTATTTTTTATCGAACAAATTATTTATTTAAAAAGTAGA
AATAGCAAACAAATCATTAAATTTAATTATTTTAAAAAAAAATGTAAACAAAAAATAATA
ATTAATATTTTAACATTTAAAAGTTGCCAATAAAACAAATATCATCAAATACAGTTGGGA
TGAAGGAAAAACATGGAGCGAATATAAATTGAGTGCTTTACCATTTGAAATAGATTAAAT
AATTACTGAGCCTAGCAATATGGAACAGAGATTTGTTGTTTATGGAAAAGGAAGAAATGG
AACAGAAACTTCTATGATTGTTTCTGTAGATTTATAAGATTTGCACATTAGAGGTTGTGT
AGGAGCTGAACATCCTAATAGACCTAATAGTGATTATGAAATCTGGATTCCTACTAATTT
TAAAGGTGAACAATGTATTTTCGGTCGTAAAGTTAAATATGTTAGAAGAAAGCCTGATGC
AAAATGCTTTAATTCTATCACAACAGATTAAGTAATTAATTTTTTAAGGATAAAAAGTTT
ATTAAAAAACAATAAATAATAGAAAACAGTTATTGAAGAATGCCCATGCACATAAGAAGA
TTGGGAATGTGACTTCGGTTTCTACAGAAAAGAAAACGAATTAGAATGTATTCCAATGAA
TGAGCATTATTCTCCTGATAATCTTGCTAAACCTCCTGCAGATTGTAGTTGGTCTTACTT
AGTCTCAAAGGTAAAAATTAGAATTTTTTTATTAGACGTTGTTATAAGGATTCTTTAATT
TAATAGGGATATAGAAAAATACCAGGAGTATTTTGTTAAGGAGGTGTTGATTTAAGTCCA
GAATATAAAGAATGTCCTCCAAAAATATCAGTGCCTAGAACTGAAGAAGAAACAGATTAA
TATAAAAGCTTCAAAGAAGCATAAAAAGAGATTATTAGCTAATATTAATAGTAATAGTAG
TAATCAAATAGTTAAAATGGAAAAACTGATTCATCATCTTCAATAAACTGGGGTGTTATT
TTTACATAAATTTTCTATGCTGGATTAATTTTAACAGCTTTAGCTTTAGCTTTCATATTT
AGAGAGAATATCAAATAAGTAGTAAAAAGCATTGGTGAAATAGGACATAATAAAGAACGC
AAATAATATTAATAACTCTAATCATCTTAGAATAAATAATCATCATACACTTAATAGAAA
AATACTCAAAATGTCCGCATTTAAGAAACTGAAGAAAGAAATTATGATTTAGAAGAATAA
GACATGCATTATCCAGAAGATGAAAAGCCTGTCTTGTAAAGAGATCAAGAAGATTACTAT
TATTAAGAAGATTACGATTGA


>TTHERM_00410210(protein)
MKIKRNQQIAIIFAIFILTAIQAADDVADDKVQQAIKSYQKQVDGGILEFEWCGTNEIYN
DETDRVVVDQEVEESFDTRIFVLTDEGQVFKSTNYGKSWVHVTKSFYGSNNQPFFSTEVS
ISPVDGKTVYIWGHKDTSYVSEECGKTWKKLNHPAGLFDFRFHRKNKNWVLAFTNIECKR
FDEDCESNMRNLYVSQDAGVTFTFLATKVLEASWNRMNNFYNVDSPGILMAVQQESQSNV
VYTEDFGKTMHTVQEGGDNFFQAEYFLFLTVKPKNSKRTYDMKIATMFDDFNYYVEPKSL
KLPFENTDQLSFTILKSDGAMVFLAIHHETQNMWQSNIYVSDWRGYDLTLALLYNVRAPN
GDCDFEKIESNEGVYIANTYDVEKVEKLRNEVKKMDISTAKNKLQTKDKKNLHKELTNYR
KSVISFDSGSSWHPIRAPSQRWNGKTVVCSGECSLHLAGRTYYKKSQMYSSSNAPGLIVA
LGSIGTHLENNFNLLNTYLSNDGGHQWREILKGPHIFEIGDHGGIIVAASVANKTNIIKY
SWDEGKTWSEYKLSALPFEIDQIITEPSNMEQRFVVYGKGRNGTETSMIVSVDLQDLHIR
GCVGAEHPNRPNSDYEIWIPTNFKGEQCIFGRKVKYVRRKPDAKCFNSITTDQKTVIEEC
PCTQEDWECDFGFYRKENELECIPMNEHYSPDNLAKPPADCSWSYLVSKGYRKIPGVFCQ
GGVDLSPEYKECPPKISVPRTEEETDQYKSFKEAQKEIISQYQQQQQQSNSQNGKTDSSS
SINWGVIFTQIFYAGLILTALALAFIFRENIKQVVKSIGEIGHNKERKQYQQLQSSQNKQ
SSYTQQKNTQNVRIQETEERNYDLEEQDMHYPEDEKPVLQRDQEDYYYQEDYD