Identifiers and Description

Gene Model Identifier

TTHERM_00412070

Standard Name

NRK32 (NIMA-Related Kinase)

Aliases

PreTt21625 | 44.m00292 | 3714.m00138

Description

NRK32 Serine/Threonine kinase domain protein; NIMA-Related Kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00069 ) protein kinase domain
  • ( PF07714 ) protein tyrosine kinase
  • ( TIGR00255 ) conserved hypothetical protein TIGR00255

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_18134.1 9.997093137033517e-262
Description: protein kinase domain-containing protein (743 aa)
Oxytricha Contig22082.0.g97 1.999872053281847e-142
Description: Protein kinase domain
Stentor Coeruleus SteCoe_18659 1.8251045143570802e-78
Description: None
WormBase WBGene00008956 1.999129405549486e-73
Description: locus:nekl-3 status:Confirmed UniProt:G5EFM9 protein_id:CAA92169.2
DictyBase DDB_G0275241 1.000499495426459e-47
Description: nek3 on chromosome: 2 position 4983790 to 4987279
SGD YMR001C 7.998932288246191e-33
Description: CDC5 Polo-like kinase with multiple functions in mitosis and cytokinesis through substrate phosphorylation, also functions in adaptation to DNA damage during meiosis; has similarity to Xenopus Plx1 and S. pombe Plo1p; possible Cdc28p substrate

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:16611747: Wloga D, Camba A, Rogowski K, Manning G, Jerka-Dziadosz M, Gaertig J (2006) Members of the NIMA-related kinase family promote disassembly of cilia by multiple mechanisms. Molecular biology of the cell 17(6):2799-810

Sequences

>TTHERM_00412070(coding)
ATGAGTAAAGACATTCAGGAGTTTACTGGAAAGGAGATTTAAGGATATACTGTATCGAAG
CCTATAGGTTAAGGCAAATTTTCAACCGTTTATAAAGCTGAAACTGCAAATAAATAAGTT
TTTGCATTGAAAAAGATAAAGATATTTGACATGATGGATCCTAAATAGCGTGAGAAATGT
TTAAAAGAAGTTGGATTGATGAAGCCACTAGATCACCCTAATATAATTAAATATATAGAT
TCCTTTATACATAATAACGAATTGATTATTGTTACAGAATGGGCAGAAAAGGGCGATTTA
AAGCGATTAATTAAAATGTAATAGCAAGAAGAAACTCCTTTTGAGGAGTTAAAAATATGG
GAATATATGTAATAGATTGCTTCTGCGTTAAATCATATGCACGAAAAAAGAATCATGCAT
AGGGATTTAAAGCCTGCCAATATATTTATAGCTCAAGATGACACTTTAAAAGTAGGAGAT
TTAGGTTTAGGTAGAGAATTTTCTTCAGGAACTATTGAAGTTTATTCTAAAGTAGGTACA
CCTTTGTATATGAGTCCAGAGCTTTTACATGGCGAGGGTTATGACATGAAAAGTGATGTT
TGGAGTTTAGGCTGTATTGTTTATGAGTTGAGTGAATTTAAAAGTCCTTTCAGAAATGAA
AATGATAAAATGAGTTTAATGGATTTATTTTAGAATATCACGAAAGGAGAATATAAGCAA
ATAAGTAAGAGATATAGTGAAGATTTATAATAAATTATAGATGATATGATAGTGGTAGAC
CCTACTAAAAGAATTGATACAGAAGTTGTTTTGCAAAGATGCGAAAAAAAAATTAATTAG
TTAAAGAAAAACCCAAAGATTGATTGTATTTTAGTTAATGAGGATATATATGAAAAACTT
ACTCTTTTGGAGTATCATAATTTTTTTTGCAAACCTATGCACAGAGATCCTGTTTCAAAA
GTGTTTTTTTCAATATCTGATTAAACTCCTGCTCAAAATAATAAGAAATTCTTCTATTTT
GCAGAGCTATGCTATTGGATAATGTCAATATAAAAATATGATAAAAAAAATAAAATATAA
GCAGCATTAAAATTAAAATCTCTTGGAAACTGGGAATCTGTTGATGAGTGTGCATAATAG
TTATTATTCGATCTTAAAAAATGGGGGCTCAGACTTCCAGACTCTTTAAATGTCTAACAC
ATTAGAAATGGATATGGTGATACAGTCTGTTTCATATTAAACGATATATTAAATAGAGAA
TTAATTAGATTAAATTTTAAATTTGAAGATCCTAAGCACACTGATGTTTAGAATGGACAG
CAAGAAACAGAAAATGGAGTTTTATAAGATCCTGATTTAAATGAGTATATGATTGAAGAG
GAGGATATATAAGATGAAGATTCTATTGTCGGAGAAGAAGAATAAGGAGATTTATTAAAT
GGGTAATATAATAAACGGTAAAATGGAGAAGAGGCTTATGATTATAAAAAAATAATAGAT
GAAGATAGAGAAATGATTATCTCGAATGTTGATCCACTAGAGTGGTAAAAAGAATGTCTT
AGAGTCACTACAGAGCTATAAAACTTTGATTTAAAAATTAAGAAAAATGAAATAACTGCA
TAGATTAACGAAAACGACTATATCAACAACTTGAATCGTCTTTAAAAATTTTAGAGAGGA
ATGAATATGCAGGCATAAATTTTGTAAGAACCTTTTGTTAATAAGATAATCACAAACTGG
TAAAACTAGCTAGATTAAATTGAAAAAGGAGAATAAAGGATTAACTAAGGAAATATTGAT
AGCATAAATGTGCTTAAAGAAAAAGTGCAAAGTAAAAAGAAATTTCTTTTGGATTTAGAG
TAAAAGTCTGAGTAAGTAAAAAGCTAAATTTAGAATTTCGATAGCATGAATGAACAATAT
GAAAAAGTTAAAAAAGAAATAGTAGAGAGAGAGAAATTGATTACAGGAAATGATTAAACT
AATAAAATAAAAGATGCAATATAAAAAATAAAAACCGAAATTAAATCGATGACAATTAAA
ATAGGTGTTTTACAAAGTAACCTCCTTTCAAAACAATTAAACATAGAATTAAATAAATTT
AAAAATGGATCTGATGATGAAGATGGTATAGATGATAATTATTTAAACGATTTATAGTAA
TCTAAAAACAACAACAAAAATAGTAACACAAATGGTGAAATAAATTAAGGATTTAGTGAT
GATCAAAATGAAGAAAATTTAATGGATATATCTGATGATAATTTTTGA


>TTHERM_00412070(gene)
ATGAGTAAAGACATTCAGGAGTTTACTGGAAAGGAGATTTAAGGATATACTGTATCGAAG
CCTATAGGTAAAACAATATATGATATACATTTATAATTCAAACAATGATTTAATATTACA
CTTACTGTCATTAATATTAAATAATTTGTTTACGGAATAAGCATTTAGTTAAAATTCATC
ATTATTTCATAGAATAAAAATAGATAATTAACTTAAATACTAGCGTTTTCTTTATAATAA
AATAGGTTAAGGCAAATTTTCAACCGTTTATAAAGCTGAAACTGCAAATAAATAAGTTTT
TGCATTGAAAAAGATAAAGGTAAACAAAATTTGGCATTATGATTTATGTGACTCTTTTAT
TAGCAAAAACAAATAACATATTTAGTTATTATTCTAAAATGAGATTAGAAAAATGTTTTT
TTTTAAAAGCTGAAATAATTTTTTATTTTAAATTAGTTTTTTTAGATAATTTATGCATCA
TTCTGTTTGTATTTAATTTTAGTATATGAATTATTATAACTTTCAAAGATTAAAAAAAGT
ATTTAGTAAACGATTTTAACAATTAAATTATTAGATATTTGACATGATGGATCCTAAATA
GCGTGAGAAATGTTTAAAAGAAGTTGGATTGATGAAGCCACTAGATCACCCTAATATAAT
TAAATATATAGATTCCTTTATACATAATAACGAATTGATTATTGTTACAGAATGGGCAGA
AAAGGGCGATTTAAAGCGATTAATTAAAATGTAATAGCAAGAAGAAACTCCTTTTGAGGA
GTTAAAAATATGGGAATATATGTAATAGATTGCTTCTGCGTTAAATCATATGCACGAAAA
AAGAATCATGCATAGGGATTTAAAGCCTGCCAATATATTTATAGCTCAAGATGACACTTT
AAAAGTAGGAGATTTAGGTTTAGGTAGAGAATTTTCTTCAGGAACTATTGAAGTTTATTC
TAAAGTAGGTACACCTTTGTATATGAGTCCAGAGGTATGTATTTATTTAATAATTATAAT
ATATTTCATATAACATAGTGACAATGAATATGAATAGGATTAGAAATAGTGCTAAAAAAT
AGCTCATTAAATAAAAATATATCAAATAAATTTATTTTTGAAGCGTTTTTAAATTTAAAA
ATGTTCATAAAAAATAATACCAAATGATAAAATAATGCTACAGACCTATTTAGCTTTTAA
TGATACAAAAAATTTAGCTTGAATAAGATAAAAAATAATTAAACTTAAAATTGCTTATAA
TATTTTTAAAATAAATTATCTATTTCAAGAAAAATATTTAATTTTTGTAGTTGTCTTTTT
TAATTTTTAGTAAAAGGTAATTAACTTATTTTTAATTAAAAGCTTTTACATGGCGAGGGT
TATGACATGAAAAGTGATGTTTGGAGTTTAGGCTGTATTGTTTATGAGTTGAGTGAATTT
AAAAGTCCTTTCAGAAATGAAAATGATAAAATGAGTTTAATGGATTTATTTTAGAATATC
ACGAAAGGTAAAAAAATAATAATAAAAATGATGAAAGATTTAAACAATAAATAAAAAAAA
TAGGAGAATATAAGCAAATAAGTAAGAGATATAGTGAAGATTTATAATAAATTATAGATG
ATATGATAGTGGTAGACCCTACTAAAAGAATTGATACAGAAGTTGTTTTGCAAAGATGCG
AAAAAAAAATTAATTAGTTAAAGAAAAACCCAAAGATTGATTGTATTTTAGTAAATAAAT
GATTGAATATTTTTATAATAATTAAATATTTATTTATTACTTTTAAATAATTTAACAGGT
TAATGAGGATATATATGAAAAACTTACTCTTTTGGAGTATCATAATTTTTTTTGCAAACC
TATGCACAGAGATCCTGTTTCAAAAGTGTTTTTTTCAATATCTGATTAAACTCCTGCTCA
AAATAATAAGAAATTCTTCTATTTTGCAGAGCTATGCTATTGGATAATGTCAATATAAAA
AGTAACTTCTTATTTAAAAAAATTTACTTACTTTATTTTGTAATTAATTATGTTAATGCT
CATTCATTTTTTTTTAGTATGATAAAAAAAATAAAATATAAGCAGCATTAAAATTAAAAT
CTCTTGGAAACTGGGAATCTGTTGATGAGTGTGCATAATAGTTATTATTCGATCTTAAAA
AATGGGGGCTCAGACTTCCAGACTCTTTAAATGTCTAACACATTAGAAATGTAATTTTTT
TAAAGGATTCAAACAGATTTTAACAATAATTATTACATCAAAAAATATAAATAAACGAAA
AAGTTTTGAAATATGATAAATGCTTATTTAAAAATAAACAATAAATTAATTCATTTTACA
ATTTATTTTTAAAAAAAACAGGGATATGGTGATACAGTCTGTTTCATATTAAACGATATA
TTAAATAGAGAATTAATTAGATTAAATTTTAAATTTGAAGATCCTAAGCACACTGATGTT
TAGAATGGACAGCAAGAAACAGAAAATGGAGTTTTATAAGATCCTGATTTAAATGAGTAT
ATGATTGAAGAGGAGGATATATAAGATGAAGATTCTATTGTCGGAGAAGAAGAATAAGGA
GATTTATTAAATGGGTAATATAATAAACGGTAAAATGGAGAAGAGGCTTATGATTATAAA
AAAATAATAGATGAAGATAGAGAAATGATTATCTCGAATGTTGATCCACTAGAGTGGTAA
AAAGAATGTCTTAGAGTCACTACAGAGCTATAAAACTTTGATTTAAAAATTAAGAAAAAT
GAAATAACTGCATAGATTAACGAAAACGACTATATCAACAACTTGAATCGTCTTTAAAAA
TTTTAGAGAGTATTTATTAATTTTTACTTTTATAAAAGAATAATAAAATAAAATTGTATC
AAAGGGAATGAATATGCAGGCATAAATTTTGTAAGAACCTTTTGTTAATAAGATAATCAC
AAACTGGTAAAACTAGCTAGATTAAATTGAAAAAGGAGAATAAAGGATTAACTAAGGAAA
TATTGATAGCATAAATGTGCTTAAAGAAAAAGTGCAAAGTAAAAAGAAATTTCTTTTGGA
TTTAGAGTAAAAGTCTGAGTAAGTAAAAAGCTAAATTTAGAATTTCGATAGCATGAATGA
ACAATATGAAAAAGTTAAAAAAGAAATAGTAGAGAGAGAGAAATTGATTACAGGAAATGA
TTAAACTAATAAAATAAAAGATGCAATATAAAAAATAAAAGTAAATTACAAATTTCAAAT
GTTTTATATTAATAAATTATTTGTTTTAAAAAGACCGAAATTAAATCGATGACAATTAAA
ATAGGTGTTTTACAAAGTAACCTCCTTTCAAAACAATTAAACATAGAATTAAATAAATTT
AAAAATGGATCTGATGATGAAGATGGTATAGATGATAATTATTTAAACGATTTATAGTAA
TCTAAAAACAACAACAAAAATAGTAACACAAATGGTGAAATAAATTAAGGATTTAGTGAT
GATCAAAATGAAGAAAATTTAATGGATATATCTGATGATAATTTTTGA


>TTHERM_00412070(protein)
MSKDIQEFTGKEIQGYTVSKPIGQGKFSTVYKAETANKQVFALKKIKIFDMMDPKQREKC
LKEVGLMKPLDHPNIIKYIDSFIHNNELIIVTEWAEKGDLKRLIKMQQQEETPFEELKIW
EYMQQIASALNHMHEKRIMHRDLKPANIFIAQDDTLKVGDLGLGREFSSGTIEVYSKVGT
PLYMSPELLHGEGYDMKSDVWSLGCIVYELSEFKSPFRNENDKMSLMDLFQNITKGEYKQ
ISKRYSEDLQQIIDDMIVVDPTKRIDTEVVLQRCEKKINQLKKNPKIDCILVNEDIYEKL
TLLEYHNFFCKPMHRDPVSKVFFSISDQTPAQNNKKFFYFAELCYWIMSIQKYDKKNKIQ
AALKLKSLGNWESVDECAQQLLFDLKKWGLRLPDSLNVQHIRNGYGDTVCFILNDILNRE
LIRLNFKFEDPKHTDVQNGQQETENGVLQDPDLNEYMIEEEDIQDEDSIVGEEEQGDLLN
GQYNKRQNGEEAYDYKKIIDEDREMIISNVDPLEWQKECLRVTTELQNFDLKIKKNEITA
QINENDYINNLNRLQKFQRGMNMQAQILQEPFVNKIITNWQNQLDQIEKGEQRINQGNID
SINVLKEKVQSKKKFLLDLEQKSEQVKSQIQNFDSMNEQYEKVKKEIVEREKLITGNDQT
NKIKDAIQKIKTEIKSMTIKIGVLQSNLLSKQLNIELNKFKNGSDDEDGIDDNYLNDLQQ
SKNNNKNSNTNGEINQGFSDDQNEENLMDISDDNF