Identifiers and Description

Gene Model Identifier

TTHERM_00414230

Standard Name

KAT2 (KATanin )

Aliases

PreTt13501 | 45.m00146 | 3833.m00703

Description

KAT2 katanin p60 ATPase subunit A-like protein; katanin p60 catalytic subunit-like protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Molecular Function

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_06067.1 9.997093137033517e-262
Description: ATPase, AAA family protein (539 aa)
Oxytricha Contig455.1.g24 8.000194140818961e-170
Description: ATPase family associated with various cellular activities (AAA)
SGD YPR173C 1.9993206333383003e-80
Description: VPS4 AAA-ATPase involved in multivesicular body (MVB) protein sorting, ATP-bound Vps4p localizes to endosomes and catalyzes ESCRT-III disassembly and membrane release; ATPase activity is activated by Vta1p; regulates cellular sterol metabolism
WormBase WBGene00021334 8.998448382613942e-77
Description: locus:vps-4 status:Confirmed UniProt:Q9BL83 protein_id:CCD68056.1
DictyBase DDB_G0284347 1.0004671766404936e-76
Description: vps4 on chromosome: 4 position 1865073 to 1866634
Stentor Coeruleus SteCoe_26448 2.194878508014299e-72
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00414230(coding)
ATGAGTTATCTACTATCAAAAGTCCGCTCAGAAGGTGAATCTCGTATGAATGAAGAAAAG
AAAATTGCTGATCGTAAAAGAAACTTAATAGTGCTTATATTGAGATACCTAACAAACATT
GGGTATATAGAATCATCTTAAAAGCTTGAATCAGAATCTCATATAAGCCTTGACAGCTGG
GAAGTAGCAGACAATATAGATTTGTATTAAATAATTATGGAGTTTGAATAATACTATGAT
ATAAGATTTGGAAAGCTTCCTAAGCTAGTAAGAAAGGTTAATGATGACTAAAAAAAAAAG
ATGCCATCTTTTCCGAAGATATCTACTCCAACAAAAGCATCAAGCACTTCAAGCAATATA
AAATAAGAATTATAAAATAACAGCAATTCTAGCGTGAACAGCAATTTAAATACAACAGGA
TCTTCTACTTAAAGAGTAGGAAGTTAGCTAGGGGGTTTACCTCCAAAAAATTTAGCGCAG
AATGCAAATAAAAAAGTCAAATCGTAAAATAGCAGTTTGGATGAAAAAGGAGTAGACCAA
AATAACACACTTAATATGGAAATTTAGGGTTAATCAGCTCTTGGAGCTAAAAAAAATGAA
GAAGAATCTACTGAAAATAATTTTTTTGATGTTAGAGTATTAAAAGGAATGCCTGATTTT
GGTGATGTTTAAGAATTAAAAGAATTAGCTGCATATTTATAAAGGGATATACTAGTTGAA
AATCCAAATGTTAAATTTAAAGATATAGTTGGACTTGATGATGCAAAAAGATTGTTAAAA
GAGGCTGTTTAAATTCCTTTAAAATATCCTCATTTTTTCACTGGAATATTAGAACCTTGG
AGAGGAGTTCTATTATATGGACCACCAGGTACAGGTAAGACTATGCTTGCAAAAGCTGTG
GCCACAGAATGTGGAACAACATTTTTTAATATATCTGCCTCTTCTGTAGTAAGTAAATGG
AGAGGTGAATCAGAAAAGTTGATAAGAGTCCTCTTTGAATTAGCTAGACATTATTAGCCT
TCAACTATTTTCTTAGATGAATTAGATTCTATTATGTCGTAAAGAAAAGGAGGAGATAAT
GAACATGAAGGAAGTAGAAGAATGAAGACAGAGCTTTTAATATAATTAGATGGGCTGATG
AAAAACAAAGAAAGAGTTTTCTTATTAGCAGCAAGTAATTTACCATGGGATTTAGATGTA
GCAATGCTAAGAAGATTAGAAAAAAGAATTTTAGTTCCTCTTCCAAGTAAAGAAGCAAGA
TAAAATATGATTGAGTAATTTTTACCTGAAGGAATAGCATAAGATTTGAATTATCAAGAA
ATTAGTGAAGCATTAGAGAATTATTCAGGCTCAGATATAAAATTATTGTGTAAAGAAGCA
GCTATGAAACCATTAAGAAGACTTATAAATTAAATTGAAAAATCTAATATAGAATAAGAA
GATATGTAAAAAAATCGTAAGCAGAAATTTTAATAACAGCAATCAATCAATCCACAAGAA
GTAAAACCCGATCCTGTCACTAACGAAGATATTGTTGAGGCTCTTAAAACTACTAAGCCT
TCTTCTTTTATAAAAACATAAGCTTATGAAAAATGGGCTAAGGAACATGGTTCAGTTTGA


>TTHERM_00414230(gene)
ATGAGTTATCTACTATCAAAAGTCCGCTCAGGTAAATAGTTTTTGTTATAAGTTGACAAT
ATTTTAAACCATTTTAATAGATAAATAGACTTTTAAATATTATAACATAAGTATAATTTT
TGTTTTTACTATTTTAGAAGGTGAATCTCGTATGAATGAAGAAAAGAAAATTGCTGATCG
TAAAAGAAACTTAATAGTGCTTATATTGAGATACCTAACAAACATTGGGTATATAGAATC
ATCTTAAAAGCTTGAATCAGAATCTCATATAAGCCTTGACAGCTGGTAATAATCATGATG
ATATGTATTTCATTATTCAATATCTAACAATCATTATAAAAAGATTATATAAAAATAATT
ATAAAATAACAAAATTTCTAATATAGGGAAGTAGCAGACAATATAGATTTGTATTAAATA
ATTATGGAGTTTGAATAATACTATGATATAAGATTTGGAAAGCTTCCTAAGCTAGTAAGA
AAGGTTAATGATGACTAAAAAAAAAAGATGCCATCTTTTCCGAAGATATCTACTCCAACA
AAAGCATCAAGCACTTCAAGCAATATAAAATAAGAATTATAAAATAACAGCAATTCTAGC
GTGAACAGCAATTTAAATACAACAGGATCTTCTACTTAAAGAGTAGGAAGTTAGCTAGGG
GGTTTACCTCCAAAAAATTTAGCGCAGAATGCAAATAAAAAAGTCAAATCGTAAAATAGC
AGTTTGGATGAAAAAGGAGTAGACCAAAATAACACACTTAATATGGAAATTTAGGGTTAA
TCAGCTCTTGTAAAGAAGCATTTTAATTAAAAAAATAAAGAAAATATTCAATTATAATTA
GGGAGCTAAAAAAAATGAAGAAGAATCTACTGAAAATAATTTTTTTGATGTTAGAGTATT
AAAAGGAATGCCTGATTTTGGTGATGTTTAAGAATTAAAAGAATTAGCTGCATATTTATA
AAGGGATATACTAGTTGAAAATCCAAATGTTAAATTTAAAGATATAGTTGGACTTGATGA
TGCAAAAAGATTGTTAAAAGAGGCTGTTTAAATTCCTTTAAAATATCCTCATTTTTTCAC
TGGAATATTAGAACCTTGGAGAGGAGTTCTATTATATGGACCACCAGGTACAGGTAAGGT
AAGAAAATATTTAAATAGAGAGTTTATCTTATAAAATTTATTGTTCAAATAAATAGACTA
TGCTTGCAAAAGCTGTGGCCACAGAATGTGGAACAACATTTTTTAATATATCTGCCTCTT
CTGTAGTAAGTAAATGGAGAGGTGAATCAGAAAAGTTGATAAGAGTCCTCTTTGAATTAG
CTAGACATTATTAGCCTTCAACTATTTTCTTAGATGAATTAGATTCTATTATGTCGTAAA
GAAAAGGAGGAGATAGTAAGTTTCTTCTAATTTCAAATAAATTATTTTTTTCAAAAATTT
TAATAACAAAAAAATATTTAATTTTGTTTATAATAATTAAACAGATGAACATGAAGGAAG
TAGAAGAATGAAGACAGAGCTTTTAATATAATTAGATGGGCTGATGAAAAACAAAGAAAG
AGTTTTCTTATTAGCAGCAAGTAATTTACCATGGGATTTAGATGTAGCAATGCTAAGAAG
ATTAGAAAAAAGAGTAAAATATTGTTTTAATTTAAAAGAAAATAAATTCATTTAAAACCA
ATTTTTGAAAAATAAAAGATTTTAGTTCCTCTTCCAAGTAAAGAAGCAAGATAAAATATG
ATTGAGTAATTTTTACCTGAAGGAATAGCATAAGATTTGAATTATCAAGAAATTAGTGAA
GCATTAGAGGTAAATATATTTATTTAATAAAGAAAACTATTTTTTATTTTTATTTTAGAA
TTATTCAGGCTCAGATATAAAATTATTGTGTAAAGAAGCAGCTATGAAACCATTAAGAAG
ACTTATAAATTAAATTGAAAAATCTAATATAGAATAAGAAGATATGTAAAAAAATCGTAA
GCAGAAATTTTAATAACAGCAATCAATCAATCCACAAGAAGGTATGTTATTCTTAATCTT
TCAAATTTAAATAAGGAGTTTTTAATAAATAAAATCAAGTAAAACCCGATCCTGTCACTA
ACGAAGATATTGTTGAGGCTCTTAAAACTACTAAGCCTTCTTCTTTTATAAAAACATAAG
CTTATGAAAAATGGGCTAAGGAACATGGTTCAGTTTGA


>TTHERM_00414230(protein)
MSYLLSKVRSEGESRMNEEKKIADRKRNLIVLILRYLTNIGYIESSQKLESESHISLDSW
EVADNIDLYQIIMEFEQYYDIRFGKLPKLVRKVNDDQKKKMPSFPKISTPTKASSTSSNI
KQELQNNSNSSVNSNLNTTGSSTQRVGSQLGGLPPKNLAQNANKKVKSQNSSLDEKGVDQ
NNTLNMEIQGQSALGAKKNEEESTENNFFDVRVLKGMPDFGDVQELKELAAYLQRDILVE
NPNVKFKDIVGLDDAKRLLKEAVQIPLKYPHFFTGILEPWRGVLLYGPPGTGKTMLAKAV
ATECGTTFFNISASSVVSKWRGESEKLIRVLFELARHYQPSTIFLDELDSIMSQRKGGDN
EHEGSRRMKTELLIQLDGLMKNKERVFLLAASNLPWDLDVAMLRRLEKRILVPLPSKEAR
QNMIEQFLPEGIAQDLNYQEISEALENYSGSDIKLLCKEAAMKPLRRLINQIEKSNIEQE
DMQKNRKQKFQQQQSINPQEVKPDPVTNEDIVEALKTTKPSSFIKTQAYEKWAKEHGSV