Identifiers and Description

Gene Model Identifier

TTHERM_00419730

Standard Name

DRH38 (DExD/H box RNA helicase 38)

Aliases

PreTt07103 | 46.m00158 | 3679.m00008

Description

DRH38 DEAH-box nuclear pre-mRNA splicing factor

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

  • ( PF00270 ) DEAD/DEAH box helicase
  • ( PF00271 ) Helicase conserved C-terminal domain
  • ( PF04408 ) Helicase associated domain (HA2)
  • ( PF07717 ) Domain of unknown function (DUF1605)
  • ( TIGR01587 ) CRISPR-associated helicase Cas3
  • ( TIGR01967 ) ATP-dependent helicase HrpA
  • ( TIGR01970 ) ATP-dependent helicase HrpB

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Stentor Coeruleus SteCoe_525 0
Description: None
Tetrahymena borealis EI9_11089.1 9.997093137033517e-262
Description: hypothetical protein (783 aa)
Oxytricha Contig17487.0.g99 9.997093137033517e-262
Description: Helicase associated domain (HA2)
SGD YER013W 2.0005951135209932e-158
Description: PRP22 DEAH-box RNA-dependent ATPase/ATP-dependent RNA helicase, associates with lariat intermediates before the second catalytic step of splicing; mediates ATP-dependent mRNA release from the spliceosome and unwinds RNA duplexes
DictyBase DDB_G0291183 9.998596099208102e-158
Description: dhx8 on chromosome: 5 position 5107365 to 5110847
WormBase WBGene00018967 4.000899569014317e-153
Description: locus:ddx-15 status:Confirmed UniProt:G8JY03 protein_id:CCD63139.1

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00419730(coding)
ATGTGTTAGAGTTAATATAATTAATAAACAAATTAATTGGTAATTATTGTATTTATTATT
GGTATTGATAAAATGGACCCTTCCTAAAGTATAGAAGATTTTAGGAATAGTTTACCAATT
ACTGAACATAAACAAAAGATTATTGAAATAGTAAAGAATAATTTATTTTGTGTTATTACT
GGTGATACTGGTTCTGGTAAATCTACTCAGCTACCTCAATATATTTTAGATTCATAGGAG
ATTTTAGATGTGCTTAAAGAAAATTAGAAAAAATATGATTTGTAAAACAATAAAAAGTCT
AAGCTTAACCATTTGCATGAAGATAACAAAGTGAGTGTAGTAATTACATAGCCTAGAAGA
GTTGCAGCTATATCGATGGCTAAAAGAATATGTTATGAGAGAAATGTAAGCTTAGGAGAT
GATGTAGGATATACTATTAGATTTGATGATAAAACTTCTTCAAAGACTCATTTAAAATAT
ATGACTGATGGTATCCTTGTCAGAGAATGTCTGCAAGATGATACTCTCAGTAAATATAAT
GTTGTTATATTGGATGAGGCTCACGAAAGAAGTCTGTATACTGATGTTCTTTTTGCTTTA
ATCAAATAGGCTGTAAAAAAAAGATAAGGTTCCTTAAAGTTAATTGTCACATCTGCCACT
CTAAACACTGATTAATTTTCAAAGTTTTTTGATAATTGCCCTGTACTTTCTATGAAAGGA
AAGCTTTATAATGTGGAAGTTAGATACAAGCCTATTTTAATGAATTTGAGGATTGAGGAA
AGTATAAACATTATAATGAAAATTCATTTAAATGAAGGTCCTGGCGATATATTAGTTTTC
TTAACTGGATCAGAAGAATGTGAAATAGCAAAGAATTAATGTATAGAGAGGTTATAAAAA
GATTTAGAGAATGGAGTTGAGTTAGCAGGCATGATGATATTTTCACTTTATGGATCATTA
GGTTCAGAAGACTAGCAATAAATATTTATGAAAACTCCTGAAAATTGCAGAAAAGTAGTG
TTTTCAACAAACATAGCAGAAACATCTCTTACTATTGATAACATAGGATTTGTAATAGAT
TGTGGATATGTAAAATAAAAGTGCTATAACCCAAGGACAGGTATGGATGCTTTGATAGTA
GTTCCTATTTCATAAGTTCAAGCAGTGTAAAGAACTGGTAGAGCTGGTAGAACATAAGAA
GGTCTTTGTTTTAGACTTTACAGTAAAAAATTTTATGATGAAGACATGAAACCACATACA
GTGCCAGAAATAAAAAGAGTTTCATTGAATAGTGTTGTCTTAACATTAAAGAGTATGGGA
ATACATGATGTAATTAATTTTGATTATATGGAACACCCTGATAGAGAGCAGTTGCTTCAA
GCATTGAAATAACTTTATTTTCTACAGGCTATAGAACAAGATGGAAGAATTACAGATTTG
GGTAAAGAAATGAATAAATTTCCTTTAGAGCCATCCTATGCTAAGTCTCTTCTTACTAGC
TATATGCTCCGTTGCGAAGATGAAATGATAACTTTAGTTGCTTTGCTCTCATCTGAGCAA
ATTTGGAGTAAACCATCAAGAGTTAGAGCATAAGATTATGAAAGGTTTGAAGAATGTTTA
AAAAGATTTGCTGATCCAGACGGAGATCACTTTAGTCTATTAAATATTTACTATTCATGG
AAGAGAAATAAGTGCTCAGATGGGTATGCTAAATCAAACTTCTTTAACATAAGAGCCTTG
AAATAAGGAGAGAATATCAAAATATAAATAAATGACTTAATAAAGAATATTGATAAAGAT
GTTTTAAAAAAATTCTATAAAGAAGATTCTATGTATTTATATTATAAAGAAAATAGAGAA
AAAAAAGATTCAGATTCTAAAAGCAAAAGTAACTCTTAAAAAAAGGAAGATAAATATAAT
GAAAAATTTGATCAAAAAAATTAAAAATAATAAAATCCTGTCTTGACTCAATCTGATATC
TTTAGGTTAGCCTTAGCTAGCGGCTTTTATTATAATAGTGCTAGAAAAGTTTAAAATAGC
ACTGATAGTTATTTGCTTATATATCCAGAAGGAAATGTTGTTGATATAGACCCTCAATCA
GTTTATTCAATAACTTAAAATTATCCTCCTCATGTAATTTTTACAGAACTGGGTGGTACG
AATCAAGTTAGAGGAGTTATGAGATACGTTTCATAGATAGATCCCTTTTGGGTTTCGCCG
TATATACCCATGATAAAGAATGTAAATGCTAAAAGATTAGCGGGATTAGATTAGAATCAA
AATAAATAAGAAATAATTTAGAAGAAAAAAACAGATGAAGAAATATAAAAAGAGAAGTAA
GATAGAATATAAGAAATAGAAGAGAAAAAAAAATAAGCCTTAGCTCGTTTGAATGAGCGC
AAAAAATTATAAAAAAATTGA


>TTHERM_00419730(gene)
ATGTGTTAGGTATTTTCGTAATAATTTACCAATTTTCTAAATTATATTAATAAATATTTT
ATTTTAATGAAACATGTTTGGAACTCTTATAAATAATATACTCGAATTATAAATTATTAA
TAAACTTTAAACTCAAATGTTACCAAAATTAAATATAAAAATTTCTAAAATGAATTAAAT
AAATAAATAAATAATTCAAAATAATTTTTTTGTTAAATTATTTTAATTTGAAAAAATATT
ATTTTAAAATTTCATTGTGTTATTGCTATGATATGCATTAGAAGAAACTATAATATCTAG
ACAAAGAGTTAATATAATTAATAAACAAATTAATTGGTAATTATTGTATTTATTATTGGT
ATTGATAAAATGGACCCTTCCTAAAGTATAGAAGATTTTAGGAATAGTTTACCAATTACT
GAACATAAACAAAAGATTATTGAAATAGTAAAGAATAATTTATTTTGTGTTATTACTGGT
GATACTGGTTCTGGTAAATCTACTCAGCTACCTCAATATATTTTAGATTCATAGGAGATT
TTAGATGTGCTTAAAGAAAATTAGAAAAAATATGATTTGTAAAACAATAAAAAGTCTAAG
CTTAACCATTTGCATGAAGATAACAAAGTGAGTGTAGTAATTACATAGCCTAGAAGAGTT
GCAGCTATATCGATGGCTAAAAGAATATGTTATGAGAGAAATGTAAGCTTAGGAGATGAT
GTAGGATATACTATTAGATTTGATGATAAAACTTCTTCAAAGACTCATTTAAAATATATG
ACTGATGGTATCCTTGTCAGAGAATGTCTGCAAGATGATACTCTCAGTAAATATAATGTT
GTTATATTGGATGAGGCTCACGAAAGAAGTCTGTATACTGATGTTCTTTTTGCTTTAATC
AAATAGGCTGTAAAAAAAAGATAAGGTTCCTTAAAGTTAATTGTCACATCTGCCACTCTA
AACACTGATTAATTTTCAAAGTTTTTTGATAATTGCCCTGTACTTTCTATGAAAGGAAAG
CTTTATAATGTGGAAGTTAGATACAAGCCTATTTTAATGAATTTGAGGATTGAGGAAAGT
ATAAACATTATAATGAAAATTCATTTAAATGAAGGTCCTGGCGATATATTAGTTTTCTTA
ACTGGATCAGAAGAATGTGAAATAGCAAAGAATTAATGTATAGAGAGGTTATAAAAAGAT
TTAGAGAATGGAGTTGAGTTAGCAGGCATGATGATATTTTCACTTTATGGATCATTAGGT
TCAGAAGACTAGCAATAAATATTTATGAAAACTCCTGAAAATTGCAGAAAAGTAGTGTTT
TCAACAAACATAGCAGAAACATCTCTTACTATTGATAACATAGGATTTGTAATAGATTGT
GGATATGTAAAATAAAAGTGCTATAACCCAAGGACAGGTATGGATGCTTTGATAGTAGTT
CCTATTTCATAAGTTCAAGCAGTGTAAAGAACTGGTAGAGCTGGTAGAACATAAGAAGGT
CTTTGTTTTAGACTTTACAGTAAAAAATTTTATGATGAAGACATGAAACCACATACAGTG
CCAGAAATAAAAAGAGTTTCATTGAATAGTGTTGTCTTAACATTAAAGGTAAATAAATAA
ATATTTTTAAAATATTTTATTTATTGGTTGGATAAGTTTAATAATTATTTTTATTTAATT
TATTAGAGTATGGGAATACATGATGTAATTAATTTTGATTATATGGAACACCCTGATAGA
GAGCAGTTGCTTCAAGCATTGAAATAACTTTATTTTCTACAGGCTATAGAACAAGATGGA
AGAATTACAGATTTGGGTAAAGAAATGAATAAATTTCCTTTAGAGCCATCCTATGCTAAG
TCTCTTCTTACTAGCTATATGCTCCGTTGCGAAGATGAAATGATAACTTTAGTTGCTTTG
CTCTCATCTGAGCAAATTTGGAGTAAACCATCAAGAGTTAGAGCATAAGATTATGAAAGG
TTTGAAGAATGTTTAAAAAGATTTGCTGATCCAGACGGAGATCACTTTAGTCTATTAAAT
ATTTACTATTCATGGAAGAGAAATAAGTGCTCAGATGGGTATGCTAAATCAAACTTCTTT
AACATAAGAGCCTTGAAATAAGGAGAGAATATCAAAATATAAATAAATGACTTAATAAAG
AATATTGATAAAGATGTTTTAAAAAAATTCTATAAAGAAGATTCTATGTATTTATATTAT
AAAGAAAATAGAGAAAAAAAAGATTCAGATTCTAAAAGCAAAAGTAACTCTTAAAAAAAG
GAAGATAAATATAATGAAAAATTTGATCAAAAAAATTAAAAATAATAAAATCCTGTCTTG
ACTCAATCTGATATCTTTAGGTTAGCCTTAGCTAGCGGCTTTTATTATAATAGTGCTAGA
AAAGTTTAAAATAGCACTGATAGTTATTTGCTTATATATCCAGAAGGAAATGTTGTTGAT
ATAGACCCTCAATCAGTTTATTCAATAACTTAAAATTATCCTCCTCATGTAATTTTTACA
GAACTGGGTGGTACGAATCAAGTTAGAGGAGTTATGAGATACGTTTCATAGATAGATCCC
TTTTGGGTTTCGCCGTATATACCCATGATAAAGAATGTAAATGCTAAAAGATTAGCGGGA
TTAGATTAGAATCAAAATAAATAAGAAATAATTTAGAAGAAAAAAACAGATGAAGAAATA
TAAAAAGAGAAGTAAGATAGAATATAAGAAATAGAAGAGAAAAAAAAATAAGCCTTAGCT
CGTTTGAATGAGCGCAAAAAATTATAAAAAAATTGA


>TTHERM_00419730(protein)
MCQSQYNQQTNQLVIIVFIIGIDKMDPSQSIEDFRNSLPITEHKQKIIEIVKNNLFCVIT
GDTGSGKSTQLPQYILDSQEILDVLKENQKKYDLQNNKKSKLNHLHEDNKVSVVITQPRR
VAAISMAKRICYERNVSLGDDVGYTIRFDDKTSSKTHLKYMTDGILVRECLQDDTLSKYN
VVILDEAHERSLYTDVLFALIKQAVKKRQGSLKLIVTSATLNTDQFSKFFDNCPVLSMKG
KLYNVEVRYKPILMNLRIEESINIIMKIHLNEGPGDILVFLTGSEECEIAKNQCIERLQK
DLENGVELAGMMIFSLYGSLGSEDQQQIFMKTPENCRKVVFSTNIAETSLTIDNIGFVID
CGYVKQKCYNPRTGMDALIVVPISQVQAVQRTGRAGRTQEGLCFRLYSKKFYDEDMKPHT
VPEIKRVSLNSVVLTLKSMGIHDVINFDYMEHPDREQLLQALKQLYFLQAIEQDGRITDL
GKEMNKFPLEPSYAKSLLTSYMLRCEDEMITLVALLSSEQIWSKPSRVRAQDYERFEECL
KRFADPDGDHFSLLNIYYSWKRNKCSDGYAKSNFFNIRALKQGENIKIQINDLIKNIDKD
VLKKFYKEDSMYLYYKENREKKDSDSKSKSNSQKKEDKYNEKFDQKNQKQQNPVLTQSDI
FRLALASGFYYNSARKVQNSTDSYLLIYPEGNVVDIDPQSVYSITQNYPPHVIFTELGGT
NQVRGVMRYVSQIDPFWVSPYIPMIKNVNAKRLAGLDQNQNKQEIIQKKKTDEEIQKEKQ
DRIQEIEEKKKQALARLNERKKLQKN