Identifiers and Description

Gene Model Identifier

TTHERM_00419920

Standard Name

MITS6 (MED31-interacting Tetrahymena specific protein 6)

Aliases

PreTt07117 | 46.m00172 | 3679.m00022

Description

hypothetical protein; Possibly Tetrahymena specific subunit of transcriptional regulator Mediator complex. Co-purified with Med31 in AP-MS experiments.

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

No Data fetched for Gene Ontology Annotations

Domains

No Data fetched for Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11074.1 9.997093137033517e-262
Description: hypothetical protein (730 aa)

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:31280994: Garg J, Saettone A, Nabeel-Shah S, Cadorin M, Ponce M, Marquez S, Pu S, Greenblatt J, Lambert JP, Pearlman RE, Fillingham J (2019) The Med31 Conserved Component of the Divergent Mediator Complex in Tetrahymena thermophila Participates in Developmental Regulation. Current biology : CB 29(14):2371-2379.e6

Sequences

>TTHERM_00419920(coding)
ATGTAGTAAAATTCGCAAAACACAAATGTTACAACATAAAACCCATCTACTAATTTAACC
CCTTAGCAAGCTAATTAGCGAATCAATACTGAAAATTAAAAATAGTAAGTTGAAACAAAA
TGGAATATTTAATTAGACCAAAATGAAAAAGAATACATAATAGTGATTGGGCATATGAAT
TTTCCTACTTTACTAGATTATTCAAAATTAAATTTAGCTAATAAGAAGATATAACACCTT
ATTATTTCAGACATGTATTTTTAATTTCAAGAAAAGCAAATTAAGATAACATTTAGCAAA
GCGGGTTTGGGAGATTTGAATCCATATAAAGTGCTTTATAATATTTATGAAAAAATATAT
TGTCACTTTGAAAATATATAGAAAGGACGCTCTGATTTTACTAAAAACCTAGATATTTAT
CCATAGGTTGTTCATTATTTGGGAACTCCAATATCTTTTGAGATATTTTTTAGATTCAAC
TCTTATAAATATGCCAACGATAATAAACTTAAAGAAGAATGGATAAGAGTATCTAATATA
TTGTCTTATGATATTTACGATGAAGTAAGACACGATTATGAAGGTAATACTTAAGGTTAT
GACATATAGTAGCAAACTCATTCAGAATCAGATTTGGATTCTTACATGAAATTCTAGCAT
ATGTTTAAGAAAAATTTGTTTTATGGATTATTTAGTCATTTTAAATTAGAATAGATATAT
CATGCTCTAGAAGTATAATATGTGCCGTACTTCATCATATAGAAAATATTTCTTTAGTTA
GAGGATTTTTATATGACACAATATTAACTTACTGTCTAAGAAATTTAGCCACTACGAAAA
ATGGTTGATGATATCACAATGTTTCCTTCTTTTTAATGCATATTATTTACTCCTCATAAT
ACATAGAAAAAGCAAAGATCAAATAATGATAAATTTATGGCTGAAAAATTAGAATCTAGA
TCTTTTATGCAAATACGTTTTGATCTATGCCCTAATTGTTAAAAATTCATAAAGGAGACT
ACTCGAAGGTGCCTAGACCTGAAAGAAGACTATTTAAAAGCCCTGCAAAATTTATAAAGT
ACCGACCCCACTAATGCTTAAAAATAAAAATTATTATATGATAAACTCTAAGATAGTCTG
TCATAGCTTAAAGTTGCATGTAAAAATACAAACCTTCCACATTAGTACTGGCTAAAAATA
TCTTTCTGCGATTTGTTTTATTATTTTCACTAACAATAGAGAGGGTAAGATTTTGCTTAC
GGTATAGATAAACGCGGATAAATTTAAGAGTGCTTGCTTCGTTCTTTTGATGTTTTTGAA
AAAGTATTTGCAAAATATAAAAATTCAGAAGAGTAATTGAGATTTAATCATGAAAAATAG
TAAATTTCATTCTGCTATATAAATCAAGTAGAATTAGAGCTCTCTTTGCTTACTTTCTTA
TCTCTTGTTTATTAGCTGCACTTCATCTATTAGTATTATTACTTCTTTTCTTAAAGACTC
ACAAATTAATAATAAGTGGAAATTAAATATCATGAAACAAACTTAAAGTAAGGGAATATA
ATTATGGTAATTTCGTAACAAAATAGCCCATTTGAACTGTAGCTCTATGTAGAATATGAG
AAATAGGGTCTTGTTGTATTCAACACTCACATAAGGAGTATAGAAAATAGAAATTCTCAT
TCATAGACATATATCTAATTATAAAGTTGGATGTACAGAATTTTTTGCATGACTTCTTAT
ATGAAAGCAGAAGTCGCCTACACTTTTTTAAATAAAGGAAATAGATTAATTTCTTGGTTA
CAAAGAGATGAAAATAAATCAAGAAAAATTATCAGTCTCTATCAAGATCTTTTGTCTTTG
AATCTATCGATTTTTAACATAGATTTGACAAGCTATGATGAAGAAGATTAAAATATGAAA
GATTATGTTAGAAATTCTAATGCTTCAGAAGACATGTTTAAAAAATTATTAGAAATTAAT
TTCGATATTGATAAAAAAAATCAGTTAGTTATTTATAAGGAAGGTTAATATGCTTTCTTT
TTTTATTAAACTGATTCGAGCAACTAAAGAATTTTATAAAACAAAGAATACAATCCTAGC
TTAAACATTTTCAGTGACAGTGCTTAATCAATTCTGTAATTCTTAAGAAGCGTAGTTTGA


>TTHERM_00419920(gene)
ATGTAGTAAAATTCGCAAAACACAAATGTTACAACATAAAACCCATCTACTAATTTAACC
CCTTAGCAAGCTAATTAGCGAATCAATACTGAAAATTAAAAATAGTAAGTTGAAACAAAA
TGGAATATTTAATTAGACCAAAATGAAAAAGAATACATAATAGTGATTGGGCATATGAAT
TTTCCTACTTTACTAGATTATTCAAAATTAAATTTAGCTAATAAGAAGATATAACACCTT
ATTATTTCAGACATGTATTTTTAATTTCAAGAAAAGCAAATTAAGATAACATTTAGCAAA
GCGGGTTTGGGAGATTTGAATCCATATAAAGTGCTTTATAATATTTATGAAAAAATATAT
TGTCACTTTGAAAATATATAGAAAGGACGCTCTGATTTTACTAAAAACCTAGATATTTAT
CCATAGGTTGTTCATTATTTGGGAACTCCAATATCTTTTGAGATATTTTTTAGATTCAAC
TCTTATAAATATGCCAACGATAATAAACTTAAAGAAGAATGGATAAGGTAAAAAATATAT
TTTTAATCAATAGTTTCTTTAGAAGAAGTCTAAAAATGTTTGTTTGTTTTGTTATTTAGA
GTTAAATTGATGGTTTCTAAAATGTTAAATGCTAAAATAAAAGTGAAAGTGGAATTAATT
AATTACAAATTACTTATTATTTTTTACTAGACATTAATAAAAAATCTAAAATTCATTTTT
CATTTTTTACTAAAAATATAATTAGAGTATCTAATATATTGTCTTATGATATTTACGATG
AAGTAAGACACGATTATGAAGGTAATACTTAAGGTTATGACATATAGTAGCAAACTCATT
CAGAATCAGATTTGGTATTAATTTAACTTTTATAAAACAATAAATTATTATGAAGTGTTA
ATATGAGATAGTTATTTATATATTTTTTAACAAAATAAATAAATAGGATTCTTACATGAA
ATTCTAGCATATGTTTAAGAAAAATTTGTTTTATGGATTATTTAGTCATTTTAAATTAGA
ATAGATATATCATGCTCTAGAAGTATAATATGTGCCGTACTTCATCATATAGAAAATATT
TCTTTAGTTAGAGGATTTTTATATGACACAATATTAACTTACTGTCTAAGAAATTTAGCC
ACTACGAAAAATGGTTGATGATATCACAATGTTTCCTTCTTTTTAATGCATATTATTTAC
TCCTCATAATACATAGAAAAAGCAAAGATCAAATAATGATAAATTTATGGCTGAAAAATT
AGAATCTAGATCTTTTATGCAAATACGTTTTGATCTATGCCCTAATTGTTAAAAATTCAT
AAAGGAGACTACTCGAAGGTGCCTAGACCTGAAAGAAGACTATTTAAAAGCCCTGCAAAA
TTTATAAAGTACCGACCCCACTAATGCTTAAAAATAAAAATTATTATATGATAAACTCTA
AGATAGTCTGTCATAGCTTAAAGTTGCATGTAAAAATACAAACCTTCCACATTAGTACTG
GCTAAAAATATCTTTCTGCGATTTGTTTTATTATTTTCACTAACAATAGAGAGGGTAAGA
TTTTGCTTACGGTATAGATAAACGCGGATAAATTTAAGAGTGCTTGCTTCGTTCTTTTGA
TGTTTTTGAAAAAGTATTTGCAAAATATAAAAATTCAGAAGAGTAATTGAGATTTAATCA
TGAAAAATAGTAAATTTCATTCTGCTATATAAATCAAGTAGAATTAGAGCTCTCTTTGCT
TACTTTCTTATCTCTTGTTTATTAGCTGCACTTCATCTATTAGTATTATTACTTCTTTTC
TTAAAGACTCACAAATTAATAATAAGTGGAAATTAAATATCATGAAACAAACTTAAAGTA
AGGGAATATAATTATGGTAATTTCGTAACAAAATAGCCCATTTGAACTGTAGCTCTATGT
AGAATATGAGAAATAGGGTCTTGTTGTATTCAACACTCACATAAGGAGTATAGAAAATAG
AAATTCTCATTCATAGACATATATCTAATTATAAAGTTGGATGTACAGAATTTTTTGCAT
GACTTCTTATATGAAAGCAGAAGTCGCCTACACTTTTTTAAATAAAGGAAATAGATTAAT
TTCTTGGTTACAAAGAGATGAAAATAAATCAAGAAAAATTATCAGTCTCTATCAAGATCT
TTTGTCTTTGAATCTATCGATTTTTAACATAGATTTGACAAGCTATGATGAAGAAGATTA
AAATATGAAAGATTATGTTAGAAATTCTAATGCTTCAGAAGACATGTTTAAAAAATTATT
AGAAATTAATTTCGATATTGATAAAAAAAATCAGTTAGTTATTTATAAGGAAGGTTAATA
TGCTTTCTTTTTTTATTAAACTGATTCGAGCAACTAAAGAATTTTATAAAACAAAGAATA
CAATCCTAGCTTAAACATTTTCAGTGACAGTGCTTAATCAATTCTGTAATTCTTAAGAAG
CGTAGTTTGA


>TTHERM_00419920(protein)
MQQNSQNTNVTTQNPSTNLTPQQANQRINTENQKQQVETKWNIQLDQNEKEYIIVIGHMN
FPTLLDYSKLNLANKKIQHLIISDMYFQFQEKQIKITFSKAGLGDLNPYKVLYNIYEKIY
CHFENIQKGRSDFTKNLDIYPQVVHYLGTPISFEIFFRFNSYKYANDNKLKEEWIRVSNI
LSYDIYDEVRHDYEGNTQGYDIQQQTHSESDLDSYMKFQHMFKKNLFYGLFSHFKLEQIY
HALEVQYVPYFIIQKIFLQLEDFYMTQYQLTVQEIQPLRKMVDDITMFPSFQCILFTPHN
TQKKQRSNNDKFMAEKLESRSFMQIRFDLCPNCQKFIKETTRRCLDLKEDYLKALQNLQS
TDPTNAQKQKLLYDKLQDSLSQLKVACKNTNLPHQYWLKISFCDLFYYFHQQQRGQDFAY
GIDKRGQIQECLLRSFDVFEKVFAKYKNSEEQLRFNHEKQQISFCYINQVELELSLLTFL
SLVYQLHFIYQYYYFFSQRLTNQQQVEIKYHETNLKQGNIIMVISQQNSPFELQLYVEYE
KQGLVVFNTHIRSIENRNSHSQTYIQLQSWMYRIFCMTSYMKAEVAYTFLNKGNRLISWL
QRDENKSRKIISLYQDLLSLNLSIFNIDLTSYDEEDQNMKDYVRNSNASEDMFKKLLEIN
FDIDKKNQLVIYKEGQYAFFFYQTDSSNQRILQNKEYNPSLNIFSDSAQSILQFLRSVV