Identifiers and Description

Gene Model Identifier

TTHERM_00420680

Standard Name

ERS5 (glutamyl-tRNA Synthetase 5)

Aliases

PreTt07193 | 46.m00248 | 3679.m00098

Description

ERS5 glutamyl-tRNA synthetase protein; Glutamyl-tRNA synthetase family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

  • glutathionylspermidine synthase activity (IEA) | GO:0008885
  • L-histidine:2-oxoglutarate aminotransferase activity (IEA) | GO:0008110

Biological Process

  • lipoate metabolic process (IEA) | GO:0009106
  • negative regulation of biosynthetic process (IEA) | GO:0009890
  • obsolete activation of MAPKKK activity involved in cell wall organization or biogenesis (IEA) | GO:0000197
  • positive regulation of catabolic process (IEA) | GO:0009896

Domains

  • ( PF00749 ) tRNA synthetases class I (E
  • ( PF03950 ) tRNA synthetases class I (E
  • ( PF07783 ) Protein of unknown function (DUF1621)
  • ( TIGR00440 ) glutaminyl-tRNA synthetase
  • ( TIGR00463 ) glutamyl-tRNA synthetase
  • ( TIGR00464 ) glutamyl-tRNA synthetase

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11010.1 9.997093137033517e-262
Description: glutamyl-tRNA synthetase (2519 aa)
SGD YGL245W 2.0005951135209932e-158
Description: GUS1 Glutamyl-tRNA synthetase (GluRS), forms a complex with methionyl-tRNA synthetase (Mes1p) and Arc1p; complex formation increases the catalytic efficiency of both tRNA synthetases and ensures their correct localization to the cytoplasm
Oxytricha Contig21938.0.g18 2.9992103642374242e-151
Description: tRNA synthetases class I (E and Q), catalytic domain
WormBase WBGene00001337 1.0001788721085356e-149
Description: locus:ears-1 status:Confirmed UniProt:Q23315 protein_id:CAB00060.1
DictyBase DDB_G0287467 9.998173848842182e-134
Description: gluS on chromosome: 5 position 295392 to 297778
Stentor Coeruleus SteCoe_29543 1.8048513878454153e-35
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00420680(coding)
ATGCAACACTCAAAAGGTTTTAATCTAGAAGAAGAATATAAGAAGTATAAGAACGTCCTT
AAGGGAGCAAAGGAAGGAGAAGTCGTTACTCGTTTTCCTCCTGAGCCTTCTGGTTACTTG
CATATTGGTCACGCTAAGGCTGCCTTGATCAATTATCATTATTCATAAATTTACAAGGGT
AAAATGATCTTCAGAATCGATGATACCAATGTTGAAAAGGAAAAGGATGAATATGTTAAC
TCAATTATTGAAGATTTAAAGACTTTAGGCGTAAAATGGCATGGTGATATCACTCACACT
TCTGACTATTTCGACTATTTGATCGAAAAAGCTGAAGAATTAATCAAAGAAGGTAAGGCT
TATTGTGATCCTACTCCTGTTGATTAAATGAGAGATGAAAGATTAAAGATGGTAGAAAAT
GCCTACCGTAGTACTACCCCTGAAGAAAATCTCAAGATTTTCAGAGCTATGTGCTAAGGA
CCCGTTGATGGAGTCGAAGAAGTTAAAAATGCTGATGACTACTGTTTGCGTGCAAAAATC
GATATGAAGAGTCCAAATGGCTCTTTGAGAGACCCTGTTTTATTCAGAGTCAACGTTAAG
CCTCACCACCGTACTGGAACCAAGTACAGATGTTATCCTACTTATGATTTCTGTTGTCCT
CTTGTTGATAGCAAAGAAGGAGTTACTCATGCTATGAGAAGTAACGAATACTCTGATAGA
ATTCCCTAATATAACTGGGTCCTCTAAGCTTGTAAAGTTAGACCTGTTACCATTTTTGAA
TTTAGTAGATTAAATTTATAATACACTTTACTTTCTAAGAGAAAACTCTAAGAATTTGTT
GATAAGAAAGTAGTTGAAGGATGGGATGATCCTCGTTTCCCTACTGTCAAGGGTATCATC
AGAAAGGGTTTGACTGTTGAAGCTTTGACTGAATTTATGTTAGCCTAAGGTCCTTCTAAG
AATACCAATTTGATGGAATGGGATAAGATATGGTCAATCAACAAGTCTATCATCGATCCT
TTATCTGGAAGATTCTCAGCTCTTTCTTCTAAAAATCTTTCCACCGTTGAAGTTACTAAT
GTTCCTGCTGGTCACGTAGAACCTGTTGAAACTCCTCTTCATCCTAAGGAAGATCTTGGT
AAGAAAGTTATTTTCTAATCCAGTAAGCTTTTGATTGATTACGAAGATGCTGCTGCTCTT
GAAAAAGATTAAATCGTTACTTTCATGAAGTGGGGTAACTTCAAGATCTTAGAAGTTGTT
AAGCCTGAAGCTGGACCTGTTGCTGTTAAGGCTGAATTCCTTCCTGATAACAAGGACTTT
AAGAAGACTGTCAAGCTTAACTGGATTGCAGACGTTGATACTGTTAAACTAATTTTAGTT
GAATATGATCATTTACTCAGAGAAAAGAAATTATTGGAAGAAAAGGAAATGCCTTTCGAA
AAATAATTAAACGAAGTAACTAAGTACGTTACTGATGCTATTGGTGAAACTGCTCTTAAG
GATGTTAAGCTACACTAATACATCTAACTTGAAAGAAGAGGATACTACAAGGTTGATAAA
ATCCATGAAATAGATGGTAATAAGGTTCCTGAATTAATTTATGTTCCTGATGGAAAAACT
AAGCCTGTCATAATTAAATAAAATTTTCTTAAATCCCATACTTTATTAAACTTTTGA


>TTHERM_00420680(gene)
ATGCAACACTCAAAAGGTTTTAATCTAGAAGAAGAATATAAGAAGTATAAGAACGTCCTT
AAGGGAGCAAAGGAAGGAGAAGTCGTTACTCGTTTTCCTCCTGAGCCTTCTGGTTACTTG
CATATTGGTCACGCTAAGGCTGCCTTGATCAATTATCATTATTCATAAATTTACAAGGGT
AAAATGATCTTCAGAATCGATGATACCAATGTTGAAAAGGAAAAGGTAAATTAAACAATA
ATTTTAATTAGGATTAGCAGGAAAGCACAATAATTTAGGTTATATTAGAAGGAAAATTTA
AAATTTGCTGATTATTTTAAATTAGTAAATATTATTTTAAATCTAAACTATTTATATAAT
TAGGATGAATATGTTAACTCAATTATTGAAGATTTAAAGACTTTAGGCGTAAAATGGCAT
GGTGATATCACTCACACTTCTGACTATTTCGACTATTTGATCGAAAAAGCTGAAGAATTA
ATCAAAGAAGGTAAGGCTTATTGTGATCCTACTCCTGTTGATTAAATGAGAGATGAAAGA
TTAAAGATGGTAGAAAATGCCTACCGTAGTACTACCCCTGAAGAAAATCTCAAGATTTTC
AGAGCTATGTGCGTAATAGATTAAATTAATATTTCATGGAGCTCATTTTAAAAATTCTTA
ATTATTCATTTATTAGTAAGGACCCGTTGATGGAGTCGAAGAAGTTAAAAATGCTGATGA
CTACTGTTTGCGTGCAAAAATCGATATGAAGAGTCCAAATGGCTCTTTGAGAGACCCTGT
TTTATTCAGAGTCAACGTTAAGCCTCACCACCGTACTGGAACCAAGTACAGAGTAAACAA
TAAATACAGAAATATATATATATTTATATTTATATAAAAATAAATAATTTTTATGTATTT
TATTTAAAAAGTGTTATCCTACTTATGATTTCTGTTGTCCTCTTGTTGATAGCAAAGAAG
GAGTTACTCATGCTATGAGAAGTAACGAATACTCTGATAGAATTCCCTAATATAACTGGG
TCCTCTAAGCTTGTAAAGTTAGACCTGTTACCATTTTTGAATTTAGTAGATTAAATTTAT
AATACACTTTACTTTCTAAGAGAAAACTCTAAGAATTTGTTGATAAGAAAGTAGTTGAAG
GATGGGATGATCCTCGTTTCCCTACTGTCAAGGTAAATTTTTATTTTGGGCAATCCTTTA
TTAATTATGCAAAGAAAATATTTTTTAGATAATATTTAAATTTTCTTTATAAAATACTCT
AAATGTTTTTTATTTTACATTTATTTATGAATTTTTTATAAAAATAATGAATAATCAACT
TATAAAATTTAATATAGGGTATCATCAGAAAGGGTTTGACTGTTGAAGCTTTGACTGAAT
TTATGTTAGCCTAAGGTCCTTCTAAGAATACCAATTTGATGGAATGGGATAAGATATGGT
CAATCAACAAGTCTATCATCGATCCTTTATCTGGAAGATTCTCAGCTCTTTCTTCTAAAA
ATCTTTCCACCGTTGAAGTTACTAATGTTCCTGCTGGTCACGTAGAACCTGTTGAAACTC
CTCTTCATCCTAAGGTAATTTTTAATAAAAATAAATCTTGGTCTAAAAGTAATTTAAAAA
TATTAGGAAGATCTTGGTAAGAAAGTTATTTTCTAATCCAGTAAGCTTTTGATTGATTAC
GAAGATGCTGCTGCTCTTGAAAAAGGTAAAATAAATAAATATATTAGTTAACATTAAAAT
AATAATTTATTTATTATATTTAGATTAAATCGTTACTTTCATGAAGTGGGGTAACTTCAA
GATCTTAGAAGTTGTTAAGCCTGAAGCTGGACCTGTTGCTGTTAAGGCTGAATTCCTTCC
TGATAACAAGGACTTTAAGAAGACTGTCAAGCTTAACTGGATTGCAGACGTTGATACTGT
ATAAAAATAATATTTTTTTAAATATATTTTTTAATTAAATTTTAATAAAAATTAATAAAG
GTTAAACTAATTTTAGTTGAATATGATCATTTACTCAGAGAAAAGAAATTATTGGAAGAA
AAGGAAATGCCTTTCGAAAAATAATTAAACGAAGTAACTAAGTACGTTACTGATGCTATT
GGTGAAACTGCTCTTAAGGATGTTAAGCTACGTAAATATTTTCATTAAAATTGTTTAAAT
TAAAAATTTTTTACATATATTTAGACTAATACATCTAACTTGAAAGAAGAGGATACTACA
AGGTTGATAAAATCCATGAAATAGATGGTAATAAGGTTCCTGAATTAATTTATGTTCCTG
ATGGAAAAACTAAGCCTGTCGTAAGATACAAAATTTAAAAAGCAAAAATAAATTTATTAA
TTGAAATATTAGGGTAAGTGATCAGCATAATACAAATAAGAACAAGAAGAAACAAAAAAA
ACTATTTAAACCATCAAATAAAATATCTAAAATATGTTATATGTTTTTTTTATTTTAAGT
TAGATAATTAAATAAAATTTTCTTAAATCCCATACTTTATTAAACTTTTGA


>TTHERM_00420680(protein)
MQHSKGFNLEEEYKKYKNVLKGAKEGEVVTRFPPEPSGYLHIGHAKAALINYHYSQIYKG
KMIFRIDDTNVEKEKDEYVNSIIEDLKTLGVKWHGDITHTSDYFDYLIEKAEELIKEGKA
YCDPTPVDQMRDERLKMVENAYRSTTPEENLKIFRAMCQGPVDGVEEVKNADDYCLRAKI
DMKSPNGSLRDPVLFRVNVKPHHRTGTKYRCYPTYDFCCPLVDSKEGVTHAMRSNEYSDR
IPQYNWVLQACKVRPVTIFEFSRLNLQYTLLSKRKLQEFVDKKVVEGWDDPRFPTVKGII
RKGLTVEALTEFMLAQGPSKNTNLMEWDKIWSINKSIIDPLSGRFSALSSKNLSTVEVTN
VPAGHVEPVETPLHPKEDLGKKVIFQSSKLLIDYEDAAALEKDQIVTFMKWGNFKILEVV
KPEAGPVAVKAEFLPDNKDFKKTVKLNWIADVDTVKLILVEYDHLLREKKLLEEKEMPFE
KQLNEVTKYVTDAIGETALKDVKLHQYIQLERRGYYKVDKIHEIDGNKVPELIYVPDGKT
KPVIIKQNFLKSHTLLNF