Identifiers and Description

Gene Model Identifier

TTHERM_00420770

Standard Name

STX7L1 (SyTaXin 7 Like 1)

Aliases

PreTt07202 | 46.m00257 | 3679.m00107

Description

transmembrane protein putative; Syntaxin; required for mucocyst biogenesis; homolog of H. sapiens STX7

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Cellular Component

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_11001.1 9.996261361959507e-120
Description: hypothetical protein (249 aa)
SGD YOR106W 0.0007003012208360162
Description: VAM3 Syntaxin-like vacuolar t-SNARE that functions with Vam7p in vacuolar protein trafficking; mediates docking/fusion of late transport intermediates with the vacuole; has an acidic di-leucine sorting signal and C-terminal transmembrane region

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:28381425: Kaur H, Sparvoli D, Osakada H, Iwamoto M, Haraguchi T, Turkewitz AP (2017) An endosomal syntaxin and the AP-3 complex are required for formation and maturation of candidate lysosome-related secretory organelles (mucocysts) in Tetrahymena thermophila. Molecular biology of the cell 28(11):1551-1564

Sequences

>TTHERM_00420770(coding)
ATGTCCTTCCAATAAAGTTCAAAAGAAAATAGGCTTAATACATCAAATTTATAGAATGGA
AAAAATTAAAAAAGCTAGGAAGATGGATTCTTTAGCGAAGTGCAAAGTTTGTTTGCAGAA
ATTTAAAAAAACATTTAGATATAAAACTATGGAGATTGCTGTAATGTAGAAGAAAACAAT
CAAATTATTCAAGAGAACGAAAAGCTAATGAAAAAAATAAAAAATATTTTATAACAAGAG
ATAGCCAGAGATAAAAAAAACCAAAATAAAGGATATATACTGTAGTGCGAAAAGTAGTTA
TAAATGTTTCAAAAAAAATAAATGCTTCAAAGTAAAAACTTCAAGAATTAATAAGATAGT
AGCACTAAGAAGCAGAAGATGTTATACGAAGAAACATTAGATTAAAGAAAAGAGAGAATG
GAAAATGCACATAGATAAATGAGAGCTGTTCATACTATCTATTAGCAAATAGATAATATA
ACTGCATAATAAAGTTAGTAATTAAAGGTAATAGATGGACATATTGAAAGCACTTTCTCA
AATACAAAAGATACAAATAAAGAATTAGTTAGAGCAAAATAAAATCTTGATAAAAAGAAC
AAAAACAATTTTAATATGCTATTTATCTTAATAGTAGTTTTAGTGGTTATGATTATCTTT
ATAAGTTATAAATGA


>TTHERM_00420770(gene)
ATGTCCTTCCAATAAAGTTCAAAAGAAAATAGGCTTAATACATCAAATTTATAGAATGGA
AAAAATTAAAAAAGCTAGGAAGATGGTAGATTTAGTTTAACTAAAATATTATGTACTCAT
ATCAAAAATAAAATAGGATTCTTTAGCGAAGTGCAAAGTTTGTTTGCAGAAATTTAAAAA
AACATTTAGATATAAAACTATGGAGATTGCTGTAATGTAGAAGAAAACAATCAAATTATT
CAAGAGAACGAAAAGCTAATGAAAAAAATAAAAAATATTTTATAACAGTAAATTGAAAGT
TATATTTTGTAAATATTTATTTGATTAAAGCACACATATACAAATAGAGAGATAGCCAGA
GATAAAAAAAACCAAAATAAAGGATATATACTGTAGTGCGAAAAGTAGTTATAAATGTTT
CAAAAAAAATAAATGCTTCAAAGTAAAAACTTCAAGAATTAATAAGATAGTAGCACTAAG
AAGCAGAAGATGGTATAAATTAAATTTATTGTAATTTCCTTTGATTTTCATTCATATAAT
TTTAAAAAAAGATGAAGAAAATGGTTTTTTATAGGAAAAATAAGTTATGAATGACATGGA
TTTTATTGTAAAATATAATTAATATATTAATTTGGATATTAACAAATACTTTTTTAAAGT
TATACGAAGAAACATTAGATTAAAGAAAAGAGAGAATGGAAAATGCACATAGATAAATGA
GAGCTGTAAGCAAACAATATAAATAAGTGCTGTTTATTCAAATATTATTATTAATTAAAT
AGGTTCATACTATCTATTAGCAAATAGATAATATAACTGCATAATAAAGTTAGTAATTAA
AGGTAATAGATGGACATATTGAAAGCACTTTCTCAAATACAAAGTAAATCTTTGATTCAA
AAAAAAATAGAATTAAATGGCTATTTTTTAAATTTATTTAGAGATACAAATAAAGAATTA
GTTAGAGCAAAATAAAATCTTGATAAAAAGAACAAAAACAATTTTAATATGCTATTTATC
TTAATAGTAGTTTTAGTGGTTATGATTATCTTTATAAGTTATAAATGA


>TTHERM_00420770(protein)
MSFQQSSKENRLNTSNLQNGKNQKSQEDGFFSEVQSLFAEIQKNIQIQNYGDCCNVEENN
QIIQENEKLMKKIKNILQQEIARDKKNQNKGYILQCEKQLQMFQKKQMLQSKNFKNQQDS
STKKQKMLYEETLDQRKERMENAHRQMRAVHTIYQQIDNITAQQSQQLKVIDGHIESTFS
NTKDTNKELVRAKQNLDKKNKNNFNMLFILIVVLVVMIIFISYK