Identifiers and Description

Gene Model Identifier

TTHERM_00421170

Standard Name

RPB6 (RNA polymerase II subunit 6)

Aliases

PreTt07241 | 46.m00296 | 3679.m00146

Description

RPB6 DNA-directed RNA polymerase subunit K; Subunit shared in RNA polymerases I- II & III

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Biological Process

Domains

  • ( PF01192 ) RNA polymerases K / 14

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_10954.1 2.9996910481190226e-100
Description: RNA polymerase K/14 to 18 kDa subunit protein (164 aa)
Oxytricha Contig8949.0.g106 9.997975313387782e-28
Description: RNA polymerase Rpb6
SGD YPR187W 2.000130478826482e-26
Description: RPO26 RNA polymerase subunit ABC23, common to RNA polymerases I, II, and III; part of central core; similar to bacterial omega subunit
WormBase WBGene00007355 9.996273942859018e-26
Description: locus:rpb-6 Probable DNA-directed RNA polymerases I, II, and III subunit RPABC2 status:Confirmed UniProt:Q17684 protein_id:CAA90053.1
DictyBase DDB_G0291037 3.001290106883431e-24
Description: rpb6 on chromosome: 5 position 4838044 to 4838564
Stentor Coeruleus SteCoe_17283 0.00000000000003442477108469977
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00421170(coding)
ATGAGCGACTACGGTGATAACGATTACTCTGATCCTGGTAATTTTGATGAGGATAATATG
GGAGATGACATGGATGATGGAGATCAAGAATCTGAAGAAGCCTCTTCCAGATCCGGAGAT
GAGGGTGATTCAGCTGATGATTCTGATCACTCTGGAACTGAATCTGAAAGTTAATCTGAA
GTCGATAAGGACGAATATCCTGAAGAAATGGTTATCATAAAAGATTAAGATAGAGATTAA
TAAGCAAGTAAAACCAAAGTAACACCTCCTTTCCTCACAAAATATGAAAAAGCCAGAATT
ATTGGAACACGCGCCTTATAAATTGCTCAAAACTCTCCAATCTATGTAGAAACAGATGAC
AAGGACTATGATCCTATTGCTATTGCCGAAAAAGAGTTTGTCTAGAAAAAGATCCCCTTT
ATTATTAGAAGATATCTTCCCAATAAAGAATATGAAGATTGGGCTCTCGATGAATTAGAA
GTCTTAGATTGA


>TTHERM_00421170(gene)
ATGAGCGACTACGGTGATAACGATTACTCTGATCCTGGTAATTTTGATGAGGATAATATG
GGAGATGACATGGATGATGGAGATCAAGAATCTGAAGAAGCCTCTTCCAGATCCGGAGAT
GAGGGTGATTCAGCTGATGATTCTGATCACTCTGGAACTGAATCTGAAAGTTAATCTGAA
GTCGATAAGGACGAATATCCTGAAGAAATGGTTATCATAAAAGATTAAGATAGAGATTAA
TAAGCAAGTAAAACCAAAGTAACACCTCCTTTCCTCACAAAATATGAAAAAGCCAGAATT
ATTGGAACACGCGCCTTATAAATTGCTCAAAACTCTCCAATCTATGTAGAAACAGATGAC
AGTAATATAAAAATTATTTTTTTTTAAGCTTGACAGAAATAGATTACCGAAATTAGAAAA
CAAGAATATTTAGAATACCAAACTGCAATTTAATGAAAATAGCTAAGTATTTTCCTTATT
TCGATAGCATAAATAACAATTTAAGTATTTATTTGCAAGAGATAGCAAAATAATTTAAAT
TTATGGAACAAATATGAAAATGATGAAAATAAATAATAAAAAAAAACAAAATTTTTTAAA
AGGAATGAACAAAGATAGTTTTATTTCAAGCAAAAATTTGATTTTAATTTGAATATAAAT
AAAATAATTTATTTATTTTAAATAAAACAGAGGACTATGATCCTATTGCTATTGCCGAAA
AAGAGTTTGTCTAGAAAAAGATCCCCTTTATTATTAGAAGATATCTTCCCAATAAAGAAT
ATGAAGATTGGGCTCTCGATGAATTAGAAGTCTTAGATTGA


>TTHERM_00421170(protein)
MSDYGDNDYSDPGNFDEDNMGDDMDDGDQESEEASSRSGDEGDSADDSDHSGTESESQSE
VDKDEYPEEMVIIKDQDRDQQASKTKVTPPFLTKYEKARIIGTRALQIAQNSPIYVETDD
KDYDPIAIAEKEFVQKKIPFIIRRYLPNKEYEDWALDELEVLD