Identifiers and Description

Gene Model Identifier

TTHERM_00426040

Standard Name

MRNO17 (Membrane Occupation and Recognition Nexus protein other)

Aliases

PreTt14039 | 47.m00234

Description

protein kinase

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_07778.1 2.0007467515522948e-59
Description: hypothetical protein (457 aa)
DictyBase DDB_G0269152 3.9992896861436003e-19
Description: mekA on chromosome: 1 position 4015409 to 4017699
Oxytricha Contig10261.0.g8 8.99902975825788e-19
Description: Protein kinase domain
SGD YOR231W 1.999598840915195e-17
Description: MKK1 Mitogen-activated kinase kinase involved in protein kinase C signaling pathway that controls cell integrity; upon activation by Bck1p phosphorylates downstream target, Slt2p; functionally redundant with Mkk2p
WormBase WBGene00001526 2.9992476920535046e-16
Description: locus:gck-1 status:Partially_confirmed UniProt:H2L0A1 protein_id:CCD72152.2
Stentor Coeruleus SteCoe_15346 0.00000001522997974471263
Description: None

General Information

No Data fetched for General Information

Associated Literature

No Data fetched for Associated Literature

Sequences

>TTHERM_00426040(coding)
ATGAATATTTAAGAGATATCATAAGAACAAATAAATGATTATTTAACGTTAAAAAAAATA
GATATTTCAAATGAAAGAATAAAAAAAGGCATATAATATTTAAAATAATTTGATATTTTT
ATATCTAAAATCTTAGGAAATGGCTAATTTGGGATTGTTTTTTAAGGATATGATTAGCAA
AACAAAAGAAAGATTGCTATTAAGTTAATTTTTGGGTAAAATGAGTAATTTGTAAATGAA
TATATCAATGAAGCTCAACTGGCGAGACAAATTAATAGCAAGTTTGTAGTAAAAATGCAT
GACTAATTCTATGATTAAGAAAATAAAAACTACTTTATCATTTACGAATATTGTGAAGTA
GGAAATCTCTAAAATTACTACAAAGAGTTGAATTAATAGCAAATTCTAGATATAGCTATT
TATTTAACTCAAGGAATTTTAGATATTCATGCCAAATAAATCATTCATAGTGATATTAAA
CCAGAAAACATTTTATTATCTACAGAAAATGGCTAGTTGATTGCTAAAATTGGGGATTTA
GGACTTTCTAAAAAGTTGTAAAAAAATCTAACTCACATCTCTACATACTAAGGTACTTAT
TCTTTTATGGCTTATGAGTAAACTGAAGGAAAACTATGTATGGAGTCAGATTATTTCGCA
CTTGGTTCAGTTATTTGCTTTATTTCAGGAATAAATTTGCTAGATTTTATGACAATGTCA
TTGTTAAAAACTGGATATTATAAAGATAACTAAGAAAACCCTTTGATATCTTTAGCCTTA
GAATTGACGAAAAAAGAACCTTAAGAGAGAATGAAATTAAATACATTTTTATCTAAATTA
GAAAGCATGAGAAAAGATTAGCAGTAATAATAGAATAATAAAAATTCAAAAGGCAATAAT
TTTAAATCTATTAAAGCAAATATTTTTAAATTTTCTATCATAGTTCTACTTACGTTAATC
ATTATAAAAGTTGGAATCTAAATTAAATAAAATTCAACAAACAATCAAAACTACAAAAAA
ATTCTTTATCAAAATGGATCGTTCTATGAAGGCTATATAAAAAATGATGAAAAACATGGA
ATAGGTAAACTTGATTTTAATGATGGAACAATTTATGTAGGTGAATTTAAAAATGACTAA
TTTAACGGCTTTGGAAATCTCACATACAAGGAGGGTCATGTTTATGTAGGGCAGTTCAAG
GATAATTTATTTAATGGAAAAGGTTTTATTAAATATAATAATTATACAAGTTATGATGGG
GAGTTTAAGAATGGAAAATATAACGGGTATGGAGAATTTAAATAGAATAATGGAACTATG
TTAAAAGGTAAATGGAAAGAAGGAATATTCATCTAATGA


>TTHERM_00426040(gene)
ATGAATATTTAAGAGATATCATAAGAACAAATAAATGATTATTTAACGTTAAAAAAAATA
GATATTTCAAATGAAAGAATAAAAAAAGGCATATAATATTTAAAATAATTTGATATTTTT
ATATCTAAAATCTTAGGAAATGGCTAATTTGGGATTGTTTTTTAAGGATATGATTAGCAA
AACAAAAGAAAGATTGCTATTAAGTTAATTTTTGGGTAAAATGAGTAATTTGTAAATGAA
TATATCAATGAAGCTCAACTGGCGAGACAAATTAATAGCAAGTTTGTAGTAAAAATGCAT
GACTAATTCTATGATTAAGAAAATAAAAACTACTTTATCATTTACGAATATTGTGAAGTA
GGAAATCTCTAAAATTACTACAAAGAGTTGAATTAATAGCAAATTCTAGATATAGCTATT
TATTTAACTCAAGGAATTTTAGATATTCATGCCAAATAAATCATTCATAGTGATATTAAA
CCAGAAAACATTTTATTATCTACAGAAAATGGCTAGTTGATTGCTAAAATTGGGGATTTA
GGACTTTCTAAAAAGTTGTAAAAAAATCTAACTCACATCTCTACATACTAAGGTACTTAT
TCTTTTATGGCTTATGAGTAAACTGAAGGAAAACTATGTATGGAGTCAGATTATTTCGCA
CTTGGTTCAGTTATTTGCTTTATTTCAGGAATAAATTTGCTAGATTTTATGACAATGTCA
TTGTTAAAAACTGGATATTATAAAGATAACTAAGAAAACCCTTTGATATCTTTAGCCTTA
GAATTGACGAAAAAAGAACCTTAAGAGAGAATGAAATTAAATACATTTTTATCTAAATTA
GAAAGCATGAGAAAAGATTAGCAGTAATAATAGAATAATAAAAATTCAAAAGGCAATAAT
TTTAAATCTATTAAAGCAAATATTTTTAAATTTTCTATCATAGTTCTACTTACGTTAATC
ATTATAAAAGTTGGAATCTAAATTAAATAAAATTCAACAAACAATCAAAACTACAAAAAA
ATTCTTTATCAAAATGGATCGTTCTATGAAGGCTATATAAAAAATGATGAAAAACATGGA
ATAGGTAAACTTGATTTTAATGATGGAACAATTTATGTAGGTGAATTTAAAAATGACTAA
TTTAACGGCTTTGGAAATCTCACATACAAGGAGGGTCATGTTTATGTAGGGCAGTTCAAG
GATAATTTATTTAATGGAAAAGGTTTTATTAAATATAATAATTATACAAGTTATGATGGG
GAGTTTAAGAATGGAAAATATAACGGGTATGGAGAATTTAAATAGAATAATGGAACTATG
TTAAAAGGTAAATGGAAAGAAGGAATATTCATCTAATGA


>TTHERM_00426040(protein)
MNIQEISQEQINDYLTLKKIDISNERIKKGIQYLKQFDIFISKILGNGQFGIVFQGYDQQ
NKRKIAIKLIFGQNEQFVNEYINEAQLARQINSKFVVKMHDQFYDQENKNYFIIYEYCEV
GNLQNYYKELNQQQILDIAIYLTQGILDIHAKQIIHSDIKPENILLSTENGQLIAKIGDL
GLSKKLQKNLTHISTYQGTYSFMAYEQTEGKLCMESDYFALGSVICFISGINLLDFMTMS
LLKTGYYKDNQENPLISLALELTKKEPQERMKLNTFLSKLESMRKDQQQQQNNKNSKGNN
FKSIKANIFKFSIIVLLTLIIIKVGIQIKQNSTNNQNYKKILYQNGSFYEGYIKNDEKHG
IGKLDFNDGTIYVGEFKNDQFNGFGNLTYKEGHVYVGQFKDNLFNGKGFIKYNNYTSYDG
EFKNGKYNGYGEFKQNNGTMLKGKWKEGIFIQ