Identifiers and Description

Gene Model Identifier

TTHERM_00426230

Standard Name

MSH3 (homolog to human protein MSH3)

Aliases

PreTt14058 | 47.m00253 | MSH6L1

Description

MSH3 DNA mismatch repair MutS family ATPase domain protein; MutS domain III family protein

Genome Browser (Macronucleus)



Genome Browser (Micronucleus)

Gene Ontology Annotations

Molecular Function

Biological Process

  • photosynthetic electron transport in photosystem II (IEA) | GO:0009772
  • protein-FMN linkage via 1'-(8alpha-FMN)-L-histidine (IEA) | GO:0050743

Domains

Gene Expression Profile

Tetrahymena Stock Center

No Data fetched for Tetrahymena Stock Center

Homologs

Source Identifier Score
Tetrahymena borealis EI9_00176.1 9.997093137033517e-262
Description: MutS domain III family protein (2231 aa)
Oxytricha Contig820.1.g122 9.997093137033517e-262
Description: MutS domain V
DictyBase DDB_G0268614 2.000319284850678e-127
Description: msh6 on chromosome: 1 position 238722 to 242663
SGD YDR097C 9.997006461365152e-115
Description: MSH6 Protein required for mismatch repair in mitosis and meiosis, forms a complex with Msh2p to repair both single-base & insertion-deletion mispairs; potentially phosphorylated by Cdc28p
WormBase WBGene00003422 1.9994050701445255e-104
Description: locus:msh-6 status:Partially_confirmed UniProt:Q9N3T8 protein_id:CCD72556.1
Stentor Coeruleus SteCoe_17585 9.710436457780846e-67
Description: None

General Information

No Data fetched for General Information

Associated Literature

  1. Ref:23884606: Gao S, Xiong J, Zhang C, Berquist BR, Yang R, Zhao M, Molascon AJ, Kwiatkowski SY, Yuan D, Qin Z, Wen J, Kapler GM, Andrews PC, Miao W, Liu Y (2013) Impaired replication elongation in Tetrahymena mutants deficient in histone H3 Lys 27 monomethylation. Genes & development 27(15):1662-79

Sequences

>TTHERM_00426230(coding)
ATGCAAATCAACTTGAAAGCAAAAGAGTTTAGTACACTCGATGAAGATTCATCGTCAGAT
GATGATTAAGAATTCGTCAAAAGAATATTAGGATAAACTTCTAAAAATGAAAATAAATCA
GACATTAATACTAATCCGATTTAAAGCAATGCTCAAATAGGACAAAAATAGTAAAGCAAT
CTAAAATAAAATGTAGCTAATAGTTACGAAAATTAATTCAAGGGATTGAATGGGTTATAT
TAAAATAATTCACCTCAATAAAAGCTTCAGCCATAAGCTAAGACTTCATCAAATAATCTC
TCAGGAATCAACAAATCTTTATTAAATAAAAGTAAAAAGTCTACTTTAAATTAAAGTGAT
GATGAAGCTGAATAAATGAACATCGAAGAAGACTAAAATAGCGTTTAGACAAACCAAAAT
GATTTTTTAAACTAATTCTAGATGCAATCAAAACAAACTACTTTTAAGAACTCAACTTCA
AGATAAAGCAAATAGTATAGTGGAGATAATTAAAAAGGCAGCTTATCAATACCTAATAAA
GAGGAGGAATAGTTAAATTAAATCCCAAAATTTGCTTAACAAAGGTATCGTAAAGATTCC
AGATAAATTCCATTTGGGAATCCATAATATGACCCAACAACTTTGTATATTCCACCCTAA
GAATTTAGTAAACTCACAAGTGCGATGAAATAGTATTGGTAAATAAAAGCAAAGCATTTT
GACAAAATCATCTTATTCAAGATGGGAAAATTTTATGAACTCTTTTATGAAGATGCTATA
ATTGCAACTAGACTTTTAGATATCACTTTTACAAACAAAGAATTGCATTGTGGTTTCCCT
GAGAAGGCATTGGAAAAATTTGCTTCAAAGCTTGTTCAATTCGGATACAAAGTAGTTGTA
GTAGAGTAAACTTCTAAAAAGACGACTACAGGTATAGTAGACAGAGACATTACATAAATC
ATTACAAAAGGTACAATTAACTTCACTTTTGAAGAGTAAAATCACGATCCTAAGTATCTC
CTTGTTATCAGATAAAAAACAAACTAAGAGTTCGGTATAATTGTTTATGAATCTTTTACT
AGCAAAATTCAAGTCGGCCTACTGTAAGACGACAAAACATAGACAAGACTAAAATCATTT
TTATGTGTTACTAAACCTTAAGAAATAGTTTATGATCCAGGAAATATAACATCAGACATT
CTTAAAATATTGAAAAGTTAATATTTTTAGTCTGTTATGAGTCCCATGAGAGATAACAAA
GACTAATGGAGTACTCAGCTTGCAACCTTTTATATTGAGAAGCAATTTGGAAGCGAAGTG
CAAAAATACCCTCAAGAACTTAGAGATATTAGAACTAATGACGAAATTAGGGGCTAAGTT
ATTAATTTAAAATATGCTGCGCTTGCAGGATTTTTTTCATATATGGATTCTACTCTCCAG
TTAGAAAGTATTCTTAATTCCTCAGAATACGTTGAATGCGATTTCGATAATAAATAATTT
TCACAAAGAATGATCTTAGACAGCCAAGCACTTCAGCACTTAGAAATATTTGAAAACTCT
TAAACTGCTTTAACAACAACTTTTTAATAAGTTGACTAAAAGAAAGGAACACTTTTGAAT
TACCTTGACTACACTAAAACGCCATATGGTAAAAGAATGTTAAAAAAATGGGTTTGCTCT
CCATTGATTGACATTTCAGCTATAAATGATCGTTACGATGCTATTGAAGATATTTAAAAC
AATCTTGCGATGAAAGATAAGTTTTAATATGGAATAGCTAGATACGCAGATATTGAGCGT
CTTTGCTCTTCTATTTACAGATATAGCGTTAAATAAAAACATGCTGAGAAAGCTGTAATG
TATGAAAATATTTCCAGTGCAAGATTGAAAGAATTTAAAAATTTAATTAATTCAATGAAA
GAGATCGAAAAACTTATTGAAGAAACATTTATGGTTAACCAAGAAAATTTTAAGAGTTAA
AGACTCAAACGTTTATGTACTTATAGACTGAAAGGTGATCCAAAACTTTCTGGAGATTTA
CCTAAAGTCAGTAGCTTTATAAAAGTTCTTGAGGACATTATTGTCTTAGACTCTAAAGAA
AAAATAGCAGGAAAGTATATAGAATAACCAGTACCAAAGGATGGGTTTTGCTAAGAATAT
GATAGCATCAGACTTCAGATTAAAGCTTATTAAGATGAACTTGATTAATATTTAGAACAA
TTAAAAGTAAAATTCAAAACAAATGATATTTCATATGCATTTCTGAATAATAGATAATAT
GATATTTAAGTCAACAAAACTCTTTTTGATAAAATATAAAAACCTGCTGATTTCTCTCTA
TAAAGCCATTCTGGGTCGTTTCAGAGATTTACTAGCAGATTTACATCTGAAAAAGTTGCA
TTCATTGAGGAGTTGGAGGAATAACTTAAAGAAATTTTATCAAACTTCTGTGTAACTGTG
TTTAGAGAGTTCTATAAAAAGAAGCATGTTTGGGATAAATTTGTAAGTATAGTAGCTGAA
CTGGATTGCTTAATAAGCATAAGCCATGCTTGCTTTACAATGGCTGATGGTGTTATGTGC
AGACCTGTCATAAAGTTTGCAAAAAATTAAAAAGAAACCTTTTTCTATTTAAAATAAGGA
AGAAACCCTAATCTAATTTAATTGGATTTAAAATAAGTTCCAAATGATATCATTCTAGGA
AACATTGCAGGAATGAATGCTTAGCCTAATATTATGATTTTAACAGGTCCAAATATGGGT
GGTAAATCAACAACTTTAAGGTTGTTCTGTTTATCTGCTATTTTAGCTTAAATAGGTTGT
TATGTTCCTGCAGAGTAATGCGAATTTAGTTTAGTGGACAGAATTTTCACAAGAATTGGT
GCTGGTGATAAATTGATAGAAGGAAAAAGTACATTTTATATAGAAATGGAAGAAGTTAAA
AATTCAATTATGTATGGTACTTACAACAGTATTGCAATATTTGATGAATTAGGAAGAGGA
ACTTCCACATTTGATGGTGTAGCTATTGCTTTTGGAATTCTTAAATATTTTATTGAAAAA
ATTTAAAGTAGATGCATATTTGCTACCCATTTTTTCCTTTTGATAAATGAATTAAGATTT
TATAAAGAAATATCCTTTTATCATATGGAATACTATTACGATAACAAATCTAAAAAGCTC
ATATTTAAATACAAACTTAAATAAGGCAACGCAGAAAGCAGCTTTGGTATAGATTTAGCA
AAGATAGTCGGTATAGAATAATCTGTACTTAATTTAGCCTAAAAGAAGTAACTAGAATTC
GAAAACAGCTTAGAGTATGCAGAAGTAGAAAAGTAATAAACTATAAAATAGTTTAATGGG
CTCATTTCTAAGCTATTTACCTATGAAAAAGATAGAATATAATGA


>TTHERM_00426230(gene)
ATGCAAATCAACTTGAAAGCAAAAGAGTTTAGTACACTCGATGAAGATTCATCGTCAGAT
GATGATTAAGAATTCGTCAAAAGAATATTAGGATAAACTTCTAAAAATGTAAGTTCATAC
TTAAAATTTAATGATAACGACATAATATTTTTGAGATTCGCAGCACATATTAGAATTAAA
TCTAAACTTTTATTGACTATTAGGAAAATAAATCAGACATTAATACTAATCCGATTTAAA
GCAATGCTCAAATAGGACAAAAATAGTAAAGCAATCTAAAATAAAATGTAGCTAATAGTT
ACGAAAATTAATTCAAGGGATTGAATGGGTTATATTAAAATAATTCACCTCAATAAAAGC
TTCAGCCATAAGCTAAGACTTCATCAAATAATCTCTCAGGAATCAACAAATCTTTATTAA
ATAAAAGTAAAAAGTCTACTTTAAATTAAAGTGATGATGAAGCTGAATAAATGAACATCG
AAGAAGACTAAAATAGCGTTTAGACAAACCAAAATGATTTTTTAAACTAATTCTAGATGC
AATCAAAACAAACTACTTTTAAGAACTCAACTTCAAGATAAAGCAAATAGTATAGTGGAG
ATAATTAAAAAGGCAGCTTATCAATACCTAATAAAGAGGAGGAATAGTTAAATTAAATCC
CAAAATTTGCTTAACAAAGGTATCGTAAAGATTCCAGATAAATTCCATTTGGGAATCCAT
AATATGACCCAACAACTTTGTATATTCCACCCTAAGAATTTAGTAAACTCACAAGTGCGA
TGAAATAGTATTGGTAAATAAAAGCAAAGCATTTTGACAAAATCATCTTATTCAAGATGG
GAAAATTTTATGAACTCTTTTATGAAGATGCTATAATTGCAACTAGACTTTTAGATATCA
CTTTTACAAACAAAGAATTGCATTGTGGTTTCCCTGAGAAGGCATTGGAAAAATTTGCTT
CAAAGCTTGTTCAATTCGGATACAAAGTAGTTGTAGTAGAGTAAACTTCTAAAAAGACGA
CTACAGGTATAGTAGACAGAGACATTACATAAATCATTACAAAAGGTACAATTAACTTCA
CTTTTGAAGAGTAAAATCACGATCCTAAGTATCTCCTTGTTATCAGGTAAGAAAAATATT
CATTTGATCAATTTTTTTTACTTACTACTGATCAAATCTTATCAAATTCTAAGCTTAATT
AAATGGCGCTTCAATTTATTTTTTCTCAAACAATTTGATAGATTAAATTTGAAATTATCA
AAAAAACAAATTAAGATTTTTAATTCTTATTCTAAATTATTAATTTAACAATCAACAAAA
ATAAAATTCTAAAGATGGCAATCGAAAATACTTTTATCGAATATATAACACATTAGATTT
TTTGTTTAGATTATAAAAATCTAAATTTTAGATTTCTGTCTCTATTTTTTATTATTTAAA
AACATTTTCCATAACTCTATTTTAAAAAATTGATGAGTTGACTTATTTTATAATCAGGCA
ATTAAACTTTATTTGATTTTTATGTTTATAAAAAGATGATAAATGATAAATTTTCAGAAT
AAGCTTATTTTAACAATACATTATTATTAGAAGTGACTTTTACTTACATTTTAATTTTTC
TAACAAAGCAAATCGTTTATTCGAGTATTTAAGTTTCGTTAATTTATACAGTAACTCGAT
TGATGATTGTGATATAGATTATTTATGTTTTTTATTTAAAAGCAAATAATTTCTATCTAT
TTTACAAATTTACTTAAAATAGATTAATCAATTTATTTATTGATTATCTGTTTCAACCTT
GTTTTAATTTTAATAGATAAAAAACAAACTAAGAGTTCGGTATAATTGTTTATGAATCTT
TTACTAGCAAAATTCAAGTCGGCCTACTGTAAGACGACAAAACATAGACAAGACTAAAAT
CATTTTTATGTGTTACTAAACCTTAAGAAATAGTTTATGATCCAGGAAATATAACATCAG
ACATTCTTAAAATATTGAAAAGTTAATATTTTTAGTCTGTTATGAGTCCCATGAGAGATA
ACAAAGACTAATGGAGTACTCAGCTTGCAACCTTTTATATTGAGAAGCAATTTGGAAGCG
AAGTGCAAAAATACCCTCAAGAACTTAGAGATATTAGAACTAATGACGAAATTAGGGGCT
AAGTTATTAATTTAAAATATGCTGCGCTTGCAGGATTTTTTTCATATATGGATTCTACTC
TCCAGTTAGAAAGTATTCTTAATTCCTCAGAATACGTTGAATGCGATTTCGATAATAAAT
AATTTTCACAAAGAATGATCTTAGACAGCCAAGCACTTCAGCACTTAGAAATATTTGAAA
ACTCTTAAACTGCTTTAACAACAACTTTTTAATAAGTTGACTAAAAGAAAGGAACACTTT
TGAATTACCTTGACTACACTAAAACGCCATATGGTAAAAGAATGTTAAAAAAATGGGTTT
GCTCTCCATTGATTGACATTTCAGCTATAAATGATCGTTACGATGCTATTGAAGATATTT
AAAACAATCTTGCGATGAAAGATAAGTTTTAATATGGAATAGCTAGATACGCAGATATTG
AGCGTCTTTGCTCTTCTATTTACAGGTATTTATCTATCTATATTTCTTTCTCTTCTTTAG
CAAATTTCCTTTTTTTATTTAATTTATTTTATAATTAATAACATGAAAGGGTTTTTATTT
GAGTTTGATTTATAATTGTTTATTTTTAATTAAAATTGAACAGATATAGCGTTAAATAAA
AACATGCTGAGAAAGCTGTAATGTATGAAAATATTTCCAGTGCAAGATTGAAAGAATTTA
AAAATTTAATTAATTCAATGAAAGAGATCGAAAAACTTATTGAAGAAACATTTATGGTTA
ACCAAGAAAATTTTAAGAGTTAAAGACTCAAACGTTTATGTACTTATAGACTGAAAGGTG
ATCCAAAACTTTCTGGAGATTTACCTAAAGTCAGTAGCTTTATAAAAGTTCTTGAGGACA
TTATTGTCTTAGACTCTAAAGAAAAAATAGCAGGAAAGTATATAGAATAACCAGTACCAA
AGGATGGGTTTTGCTAAGAATATGATAGCATCAGACTTCAGATTAAAGCTTATTAAGATG
AACTTGATTAATATTTAGAACAATTAAAAGTAAAATTCAAAACAAATGATATTTCATATG
CATTTCTGAATAATAGATAATATGATATTTAAGTCAACAAAACTCTTTTTGATAAAATAT
AAAAACCTGCTGATTTCTCTCTATAAAGCCATTCTGGGTCGTTTCAGAGATTTACTAGCA
GATTTACATCTGAAAAAGTTGCATTCATTGAGGAGTTGGAGGAATAACTTAAAGAAATTT
TATCAAACTTCTGTGTAACTGTGTTTAGAGAGTTCTATAAAAAGAAGCATGTTGGTTTTT
CATTTTTATTTAATTTTTTGCAATTATTTTTTTATTTTAAAATCAGTTAATTTTTTTTGG
AATAAATTAAAAAATTTCACTTTAGATTTTATTAAATTTTTCAGGTTTTTAGTTGAATTA
TTTATTTACTTAACAAAAATATTTTTTAATAATTTATTATTTTGAATTTTATTTTACTTA
AAAATAAAATAGGTTTGGGATAAATTTGTAAGTATAGTAGCTGAACTGGATTGCTTAATA
AGCATAAGCCATGCTTGCTTTACAATGGCTGATGGTGTTATGTGCAGACCTGTCATAAAG
TTTGCAAAAAATTAAAAAGAAACCTTTTTCTATTTAAAATAAGGAAGAAACCCTAATCTA
ATTTAATTGGATTTAAAATAAGTTCCAAATGATATCATTCTAGGAAACATTGCAGGAATG
AATGCTTAGCCTAATATTATGATTTTAACAGGTCCAAATATGGGTGGTAAATCAACAACT
TTAAGGTTGTTCTGTTTATCTGCTATTTTAGCTTAAATAGGTATTTATTTTAGAAATTAT
TAAAATTTTAAACTGATTCTTTAATTGAAACAAGGTTGTTATGTTCCTGCAGAGTAATGC
GAATTTAGTTTAGTGGACAGAATTTTCACAAGAATTGGTGCTGGTGATAAATTGATAGAA
GGAAAAAGTACATTTTATATAGAAATGGAAGAAGTTAAAAATTCAATTATGTATGGTACT
TACAACAGTATTGCAATATTTGATGAATTAGGAAGAGGAACTTCCACATTTGATGGTGTA
GCTATTGCTTTTGGAATTCTTAAATATTTTATTGAAAAAATTTAAAGTAGATGCATATTT
GCTACCCATTTTTTCCTTTTGATAAATGAATTAAGATTTTATAAAGAAATATCCTTTTAT
CATATGGAATACTATTACGATAACAAATCTAAAAAGCTCATATTTAAATACAAACTTAAA
TAAGGCAACGCAGAAAGCAGCTTTGGTATAGATTTAGCAAAGGTAAATTAAATTTATATC
TTTATTTAAAATATGTGAAAATTAAAAAAAAATATTTTAGATAGTCGGTATAGAATAATC
TGTACTTAATTTAGCCTAAAAGAAGTAACTAGAATTCGAAAACAGCTTAGAGTATGCAGA
AGTAGAAAAGTAATAAACTATAAAATAGTTTAATGGGCTCATTTCTAAGCTATTTACCTA
TGAAAAAGATAGAATATAATGA


>TTHERM_00426230(protein)
MQINLKAKEFSTLDEDSSSDDDQEFVKRILGQTSKNENKSDINTNPIQSNAQIGQKQQSN
LKQNVANSYENQFKGLNGLYQNNSPQQKLQPQAKTSSNNLSGINKSLLNKSKKSTLNQSD
DEAEQMNIEEDQNSVQTNQNDFLNQFQMQSKQTTFKNSTSRQSKQYSGDNQKGSLSIPNK
EEEQLNQIPKFAQQRYRKDSRQIPFGNPQYDPTTLYIPPQEFSKLTSAMKQYWQIKAKHF
DKIILFKMGKFYELFYEDAIIATRLLDITFTNKELHCGFPEKALEKFASKLVQFGYKVVV
VEQTSKKTTTGIVDRDITQIITKGTINFTFEEQNHDPKYLLVIRQKTNQEFGIIVYESFT
SKIQVGLLQDDKTQTRLKSFLCVTKPQEIVYDPGNITSDILKILKSQYFQSVMSPMRDNK
DQWSTQLATFYIEKQFGSEVQKYPQELRDIRTNDEIRGQVINLKYAALAGFFSYMDSTLQ
LESILNSSEYVECDFDNKQFSQRMILDSQALQHLEIFENSQTALTTTFQQVDQKKGTLLN
YLDYTKTPYGKRMLKKWVCSPLIDISAINDRYDAIEDIQNNLAMKDKFQYGIARYADIER
LCSSIYRYSVKQKHAEKAVMYENISSARLKEFKNLINSMKEIEKLIEETFMVNQENFKSQ
RLKRLCTYRLKGDPKLSGDLPKVSSFIKVLEDIIVLDSKEKIAGKYIEQPVPKDGFCQEY
DSIRLQIKAYQDELDQYLEQLKVKFKTNDISYAFLNNRQYDIQVNKTLFDKIQKPADFSL
QSHSGSFQRFTSRFTSEKVAFIEELEEQLKEILSNFCVTVFREFYKKKHVWDKFVSIVAE
LDCLISISHACFTMADGVMCRPVIKFAKNQKETFFYLKQGRNPNLIQLDLKQVPNDIILG
NIAGMNAQPNIMILTGPNMGGKSTTLRLFCLSAILAQIGCYVPAEQCEFSLVDRIFTRIG
AGDKLIEGKSTFYIEMEEVKNSIMYGTYNSIAIFDELGRGTSTFDGVAIAFGILKYFIEK
IQSRCIFATHFFLLINELRFYKEISFYHMEYYYDNKSKKLIFKYKLKQGNAESSFGIDLA
KIVGIEQSVLNLAQKKQLEFENSLEYAEVEKQQTIKQFNGLISKLFTYEKDRIQ